| dnaA protein network | https://string-db.org/network/866895.HBHAL_1001 | Chromosomal replication initiation protein; Plays an important role in the initiation and regulation of chromosomal replication. Binds to the origin of replication; it binds specifically double-s [...] |
| dnaN protein network | https://string-db.org/network/866895.HBHAL_1002 | DNA polymerase III beta subunit; Confers DNA tethering and processivity to DNA polymerases and other proteins. Acts as a clamp, forming a ring around DNA (a reaction catalyzed by the clamp-loadin [...] |
| yaaA protein network | https://string-db.org/network/866895.HBHAL_1004 | Hypothetical protein. |
| recF protein network | https://string-db.org/network/866895.HBHAL_1005 | DNA replication and repair protein RecF; The RecF protein is involved in DNA metabolism; it is required for DNA replication and normal SOS inducibility. RecF binds preferentially to single-strand [...] |
| yaaB protein network | https://string-db.org/network/866895.HBHAL_1006 | Hypothetical protein. |
| gyrB protein network | https://string-db.org/network/866895.HBHAL_1007 | DNA gyrase subunit B; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in a [...] |
| gyrA protein network | https://string-db.org/network/866895.HBHAL_1008 | DNA gyrase subunit A; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in a [...] |
| CCG43396.1 protein network | https://string-db.org/network/866895.HBHAL_1009 | Probable metal dependent phosphohydrolase. |
| yaaC protein network | https://string-db.org/network/866895.HBHAL_1010 | Hypothetical protein. |
| guaB protein network | https://string-db.org/network/866895.HBHAL_1011 | IMP dehydrogenase; Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleoti [...] |
| dacA protein network | https://string-db.org/network/866895.HBHAL_1012 | Serine-type D-Ala-D-Ala carboxypeptidase; Belongs to the peptidase S11 family. |
| pdxS protein network | https://string-db.org/network/866895.HBHAL_1013 | Pyridoxine biosynthesis protein; Catalyzes the formation of pyridoxal 5'-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia. The ammonia is provided by the PdxT [...] |
| pdxT protein network | https://string-db.org/network/866895.HBHAL_1014 | Glutamine amidotransferase subunit PdxT; Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5'-phosphate. The resulting ammonia molecule is ch [...] |
| serS protein network | https://string-db.org/network/866895.HBHAL_1015 | seryl-tRNA synthetase; Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L- seryl-tRNA(Sec), which will be further [...] |
| CCG43403.1 protein network | https://string-db.org/network/866895.HBHAL_1016 | Deoxynucleoside kinase. |
| dgk protein network | https://string-db.org/network/866895.HBHAL_1017 | Deoxyguanosine kinase. |
| CCG43405.1 protein network | https://string-db.org/network/866895.HBHAL_1019 | ABC-type transport system ATP-binding protein (probable substrate molybdate). |
| CCG43406.1 protein network | https://string-db.org/network/866895.HBHAL_1020 | ABC-type transport system permease protein (probable substrate molybdate); Part of the binding-protein-dependent transport system for molybdenum; probably responsible for the translocation of the [...] |
| CCG43407.1 protein network | https://string-db.org/network/866895.HBHAL_1021 | ABC-type transport system extracellular binding protein (probable substrate molybdate). |
| CCG43408.1 protein network | https://string-db.org/network/866895.HBHAL_1022 | Conserved hypothetical protein. |
| CCG43410.1 protein network | https://string-db.org/network/866895.HBHAL_1024 | Hypothetical protein. |
| CCG43411.1 protein network | https://string-db.org/network/866895.HBHAL_1025 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| CCG43412.1 protein network | https://string-db.org/network/866895.HBHAL_1026 | Aminoglycoside N3'-acetyltransferase. |
| queF protein network | https://string-db.org/network/866895.HBHAL_1027 | 7-cyano-7-deazaguanine reductase; Catalyzes the NADPH-dependent reduction of 7-cyano-7- deazaguanine (preQ0) to 7-aminomethyl-7-deazaguanine (preQ1). Belongs to the GTP cyclohydrolase I family. Q [...] |
| acsA protein network | https://string-db.org/network/866895.HBHAL_1028 | acetyl-CoA synthetase. |
| CCG43415.1 protein network | https://string-db.org/network/866895.HBHAL_1029 | Xanthine/uracil permease family protein. |
| CCG43416.1 protein network | https://string-db.org/network/866895.HBHAL_1030 | Monooxygenase (probable substrate lysine/ornithine). |
| CCG43417.1 protein network | https://string-db.org/network/866895.HBHAL_1031 | ThiJ/PfpI domain protein. |
| CCG43418.1 protein network | https://string-db.org/network/866895.HBHAL_1032 | Hypothetical protein. |
| CCG43419.1 protein network | https://string-db.org/network/866895.HBHAL_1033 | Hypothetical protein. |
| CCG43420.1 protein network | https://string-db.org/network/866895.HBHAL_1034 | Spore germination protein. |
| yaaJ protein network | https://string-db.org/network/866895.HBHAL_1035 | Hypothetical protein; Catalyzes the deamination of adenosine to inosine at the wobble position 34 of tRNA(Arg2); Belongs to the cytidine and deoxycytidylate deaminase family. |
| dnaX protein network | https://string-db.org/network/866895.HBHAL_1036 | DNA polymerase III gamma/tau subunit; DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' [...] |
| yaaK protein network | https://string-db.org/network/866895.HBHAL_1037 | Conserved hypothetical protein; Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. |
| recR protein network | https://string-db.org/network/866895.HBHAL_1038 | Recombination protein RecR; May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO. |
| CCG43425.1 protein network | https://string-db.org/network/866895.HBHAL_1039 | Hypothetical protein. |
| CCG43426.1 protein network | https://string-db.org/network/866895.HBHAL_1040 | Inhibitor of the pro-sigma K processing machinery. |
| CCG43427.1 protein network | https://string-db.org/network/866895.HBHAL_1043 | Lysine decarboxylase. |
| tmk protein network | https://string-db.org/network/866895.HBHAL_1044 | Thymidylate kinase; Phosphorylation of dTMP to form dTDP in both de novo and salvage pathways of dTTP synthesis; Belongs to the thymidylate kinase family. |
| yaaQ protein network | https://string-db.org/network/866895.HBHAL_1045 | Hypothetical protein. |
| yaaR protein network | https://string-db.org/network/866895.HBHAL_1046 | Conserved hypothetical protein. |
| holB protein network | https://string-db.org/network/866895.HBHAL_1047 | DNA polymerase III delta' subunit. |
| CCG43432.1 protein network | https://string-db.org/network/866895.HBHAL_1048 | Hypothetical protein. |
| yabA protein network | https://string-db.org/network/866895.HBHAL_1049 | DNA replication intiation control protein YabA; Involved in initiation control of chromosome replication. Belongs to the YabA family. |
| yabB protein network | https://string-db.org/network/866895.HBHAL_1050 | Hypothetical protein. |
| yazA protein network | https://string-db.org/network/866895.HBHAL_1051 | UPF0213 family protein. |
| rsmI protein network | https://string-db.org/network/866895.HBHAL_1052 | 16S rRNA cytidine-2'-O-methyltransferase RsmI; Catalyzes the 2'-O-methylation of the ribose of cytidine 1402 (C1402) in 16S rRNA. |
| abrB protein network | https://string-db.org/network/866895.HBHAL_1053 | Transition state regulatory protein AbrB. |
| metS protein network | https://string-db.org/network/866895.HBHAL_1054 | methionyl-tRNA synthetase; Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation. |
| tatD protein network | https://string-db.org/network/866895.HBHAL_1055 | Deoxyribonuclease, TatD family. |
| CCG43440.1 protein network | https://string-db.org/network/866895.HBHAL_1056 | Conserved hypothetical protein. |
| rnmV protein network | https://string-db.org/network/866895.HBHAL_1057 | Ribonuclease M5; Required for correct processing of both the 5' and 3' ends of 5S rRNA precursor. Cleaves both sides of a double-stranded region yielding mature 5S rRNA in one step. |
| ksgA protein network | https://string-db.org/network/866895.HBHAL_1058 | Dimethyladenosine transferase; Specifically dimethylates two adjacent adenosines (A1518 and A1519) in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a c [...] |
| CCG43443.1 protein network | https://string-db.org/network/866895.HBHAL_1059 | Sporulation-specific protease. |
| veg protein network | https://string-db.org/network/866895.HBHAL_1060 | Hypothetical protein. |
| CCG43445.1 protein network | https://string-db.org/network/866895.HBHAL_1061 | Small acid-soluble spore protein. |
| ispE protein network | https://string-db.org/network/866895.HBHAL_1062 | 4-diphosphocytidyl-2-C-methyl-D- erythritolkinase; Catalyzes the phosphorylation of the position 2 hydroxy group of 4-diphosphocytidyl-2C-methyl-D-erythritol. |
| purR protein network | https://string-db.org/network/866895.HBHAL_1063 | Purine operon repressor. |
| spoVG protein network | https://string-db.org/network/866895.HBHAL_1064 | Regulatory protein SpoVG; Could be involved in septation. |
| gcaD protein network | https://string-db.org/network/866895.HBHAL_1065 | UDP-N-acetylglucosamine diphosphorylase; Catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-N-acetylglucosamine (UDP-GlcNAc). The C- terminal domain catalyzes [...] |
| prs1 protein network | https://string-db.org/network/866895.HBHAL_1066 | Ribose-phosphate pyrophosphokinase; Involved in the biosynthesis of the central metabolite phospho-alpha-D-ribosyl-1-pyrophosphate (PRPP) via the transfer of pyrophosphoryl group from ATP to 1-hy [...] |
| rplY protein network | https://string-db.org/network/866895.HBHAL_1067 | 50S ribosomal protein L25; This is one of the proteins that binds to the 5S RNA in the ribosome where it forms part of the central protuberance. Belongs to the bacterial ribosomal protein bL25 fa [...] |
| pth protein network | https://string-db.org/network/866895.HBHAL_1068 | peptidyl-tRNA hydrolase; The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis. Belongs to the PTH family. |
| yabK protein network | https://string-db.org/network/866895.HBHAL_1069 | Hypothetical protein. |
| mfd protein network | https://string-db.org/network/866895.HBHAL_1070 | Transcription-repair coupling factor; Couples transcription and DNA repair by recognizing RNA polymerase (RNAP) stalled at DNA lesions. Mediates ATP-dependent release of RNAP and its truncated tr [...] |
| CCG43455.1 protein network | https://string-db.org/network/866895.HBHAL_1071 | Stage V sporulation protein T. |
| CCG43456.1 protein network | https://string-db.org/network/866895.HBHAL_1072 | Putative polysaccharide biosynthesis protein. |
| yabN protein network | https://string-db.org/network/866895.HBHAL_1073 | Tetrapyrrole methylase family protein / MazG family protein. |
| yabO protein network | https://string-db.org/network/866895.HBHAL_1074 | S4 domain protein. |
| CCG43459.1 protein network | https://string-db.org/network/866895.HBHAL_1075 | Hypothetical protein. |
| CCG43460.1 protein network | https://string-db.org/network/866895.HBHAL_1076 | IS231-type transposase. |
| CCG43461.1 protein network | https://string-db.org/network/866895.HBHAL_1077 | Conserved hypothetical protein. |
| CCG43462.1 protein network | https://string-db.org/network/866895.HBHAL_1078 | Conserved hypothetical protein. |
| CCG43463.1 protein network | https://string-db.org/network/866895.HBHAL_1079 | Cell-division initiation protein. |
| CCG43464.1 protein network | https://string-db.org/network/866895.HBHAL_1080 | rp-S1 RNA binding domain protein. |
| hemL protein network | https://string-db.org/network/866895.HBHAL_1081 | Glutamate-1-semialdehyde 2,1-aminomutase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. |
| CCG43466.1 protein network | https://string-db.org/network/866895.HBHAL_1082 | Stage II sporulation protein E. |
| CCG43467.1 protein network | https://string-db.org/network/866895.HBHAL_1083 | Conserved hypothetical protein. |
| yabT protein network | https://string-db.org/network/866895.HBHAL_1084 | Serine/threonine-protein kinase. |
| tilS protein network | https://string-db.org/network/866895.HBHAL_1085 | tRNA(Ile)-lysidine synthetase; Ligates lysine onto the cytidine present at position 34 of the AUA codon-specific tRNA(Ile) that contains the anticodon CAU, in an ATP-dependent manner. Cytidine is [...] |
| hprT protein network | https://string-db.org/network/866895.HBHAL_1086 | Hypoxanthine-guanine phosphoribosyltransferase; Belongs to the purine/pyrimidine phosphoribosyltransferase family. |
| ftsH protein network | https://string-db.org/network/866895.HBHAL_1087 | ATP-dependent metalloprotease FtsH; Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane [...] |
| coaX protein network | https://string-db.org/network/866895.HBHAL_1088 | Pantothenate kinase; Catalyzes the phosphorylation of pantothenate (Pan), the first step in CoA biosynthesis. |
| hslO protein network | https://string-db.org/network/866895.HBHAL_1089 | HSP33-like chaperonin; Redox regulated molecular chaperone. Protects both thermally unfolding and oxidatively damaged proteins from irreversible aggregation. Plays an important role in the bacter [...] |
| cysK1 protein network | https://string-db.org/network/866895.HBHAL_1090 | Cysteine synthase; Belongs to the cysteine synthase/cystathionine beta- synthase family. |
| folP protein network | https://string-db.org/network/866895.HBHAL_1091 | Dihydropteroate synthase; Catalyzes the condensation of para-aminobenzoate (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate (DHPt-PP) to form 7,8- dihydropteroate (H2Pte), the immediate [...] |
| folB protein network | https://string-db.org/network/866895.HBHAL_1092 | Dihydroneopterin aldolase; Catalyzes the conversion of 7,8-dihydroneopterin to 6- hydroxymethyl-7,8-dihydropterin. |
| folK protein network | https://string-db.org/network/866895.HBHAL_1093 | 2-amino-4-hydroxy-6- hydroxymethyldihydropteridinepyrophosphokinase. |
| lysS protein network | https://string-db.org/network/866895.HBHAL_1094 | lysyl-tRNA synthetase; Belongs to the class-II aminoacyl-tRNA synthetase family. |
| CCG43479.1 protein network | https://string-db.org/network/866895.HBHAL_1098 | Putative MgtC family transporter (probable substrate magnesium). |
| ctsR protein network | https://string-db.org/network/866895.HBHAL_1099 | Transcription regulator CtsR; Belongs to the CtsR family. |
| CCG43481.1 protein network | https://string-db.org/network/866895.HBHAL_1100 | Hypothetical protein. |
| mcsB protein network | https://string-db.org/network/866895.HBHAL_1101 | Putative ATP:guanido phosphotransferase; Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein argini [...] |
| clpC protein network | https://string-db.org/network/866895.HBHAL_1102 | ATP-dependent Clp protease ATP-binding subunit ClpC; Belongs to the ClpA/ClpB family. |
| radA protein network | https://string-db.org/network/866895.HBHAL_1103 | DNA repair protein RadA; DNA-dependent ATPase involved in processing of recombination intermediates, plays a role in repairing DNA breaks. Stimulates the branch migration of RecA-mediated strand [...] |
| disA protein network | https://string-db.org/network/866895.HBHAL_1104 | DNA integrity scanning protein DisA; Has also diadenylate cyclase activity, catalyzing the condensation of 2 ATP molecules into cyclic di-AMP (c-di-AMP). c-di-AMP acts as a signaling molecule tha [...] |
| yacL protein network | https://string-db.org/network/866895.HBHAL_1105 | Hypothetical protein. |
| ispD protein network | https://string-db.org/network/866895.HBHAL_1106 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Bifunctional enzyme that catalyzes the formation of 4- diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D- erythritol 4-p [...] |
| gltX protein network | https://string-db.org/network/866895.HBHAL_1107 | glutamyl-tRNA synthetase; Catalyzes the attachment of glutamate to tRNA(Glu) in a two- step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end [...] |
| cysE protein network | https://string-db.org/network/866895.HBHAL_1108 | Serine O-acetyltransferase. |
| cysS protein network | https://string-db.org/network/866895.HBHAL_1109 | cysteinyl-tRNA synthetase; Belongs to the class-I aminoacyl-tRNA synthetase family. |
| mrnC protein network | https://string-db.org/network/866895.HBHAL_1110 | Ribonuclease MrnC; Involved in correct processing of both the 5' and 3' ends of 23S rRNA precursor. Processes 30S rRNA precursor transcript even in absence of ribonuclease 3 (Rnc); Rnc processes [...] |
| CCG43492.1 protein network | https://string-db.org/network/866895.HBHAL_1111 | RNA methyltransferase, TrmH family, group 3; Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family. |
| yacP protein network | https://string-db.org/network/866895.HBHAL_1112 | Conserved hypothetical protein. |
| sigH protein network | https://string-db.org/network/866895.HBHAL_1113 | RNA polymerase sigma factor SigH; Belongs to the sigma-70 factor family. |
| rpmG1 protein network | https://string-db.org/network/866895.HBHAL_1114 | 50S ribosomal protein L33; Belongs to the bacterial ribosomal protein bL33 family. |
| secE protein network | https://string-db.org/network/866895.HBHAL_1115 | Hypothetical protein; Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. |
| nusG protein network | https://string-db.org/network/866895.HBHAL_1116 | Transcription antitermination protein NusG; Participates in transcription elongation, termination and antitermination. |
| rplK protein network | https://string-db.org/network/866895.HBHAL_1117 | 50S ribosomal protein L11; Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. |
| rplA protein network | https://string-db.org/network/866895.HBHAL_1118 | 50S ribosomal protein L1; Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release. |
| rplJ protein network | https://string-db.org/network/866895.HBHAL_1119 | 50S ribosomal protein L10; Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors. Belongs to the universal ribosomal prot [...] |
| rplL protein network | https://string-db.org/network/866895.HBHAL_1120 | 50S ribosomal protein L7/L12; Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation; Belongs to the ba [...] |
| CCG43502.1 protein network | https://string-db.org/network/866895.HBHAL_1121 | Putative 16S rRNA methyltransferase. |
| rpoB protein network | https://string-db.org/network/866895.HBHAL_1122 | DNA-directed RNA polymerase beta subunit; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. |
| rpoC protein network | https://string-db.org/network/866895.HBHAL_1123 | DNA-directed RNA polymerase beta' subunit; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. |
| rplGB protein network | https://string-db.org/network/866895.HBHAL_1124 | L7Ae-like ribosome-associated protein. |
| rpsL protein network | https://string-db.org/network/866895.HBHAL_1125 | 30S ribosomal protein S12; Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S an [...] |
| rpsG protein network | https://string-db.org/network/866895.HBHAL_1126 | 30S ribosomal protein S7; One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit inte [...] |
| fusA protein network | https://string-db.org/network/866895.HBHAL_1127 | Translation elongation factor G; Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) [...] |
| tuf protein network | https://string-db.org/network/866895.HBHAL_1128 | Translation elongation factor Tu; This protein promotes the GTP-dependent binding of aminoacyl- tRNA to the A-site of ribosomes during protein biosynthesis. |
| rpsJ protein network | https://string-db.org/network/866895.HBHAL_1129 | 30S ribosomal protein S10; Involved in the binding of tRNA to the ribosomes. Belongs to the universal ribosomal protein uS10 family. |
| rplC protein network | https://string-db.org/network/866895.HBHAL_1130 | 50S ribosomal protein L3; One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit; Belongs to the universal rib [...] |
| rplD protein network | https://string-db.org/network/866895.HBHAL_1131 | 50S ribosomal protein L4; Forms part of the polypeptide exit tunnel. |
| rplW protein network | https://string-db.org/network/866895.HBHAL_1132 | 50S ribosomal protein L23; One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main dock [...] |
| rplB protein network | https://string-db.org/network/866895.HBHAL_1133 | 50S ribosomal protein L2; One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It [...] |
| rpsS protein network | https://string-db.org/network/866895.HBHAL_1134 | 30S ribosomal protein S19; Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA. |
| rplV protein network | https://string-db.org/network/866895.HBHAL_1135 | 50S ribosomal protein L22; The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wal [...] |
| rpsC protein network | https://string-db.org/network/866895.HBHAL_1136 | 30S ribosomal protein S3; Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation; Belongs to the universal ribosomal protein uS3 family. |
| rplP protein network | https://string-db.org/network/866895.HBHAL_1137 | 50S ribosomal protein L16; Binds 23S rRNA and is also seen to make contacts with the A and possibly P site tRNAs; Belongs to the universal ribosomal protein uL16 family. |
| rpmC protein network | https://string-db.org/network/866895.HBHAL_1138 | 50S ribosomal protein L29; Belongs to the universal ribosomal protein uL29 family. |
| rpsQ protein network | https://string-db.org/network/866895.HBHAL_1139 | 30S ribosomal protein S17; One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA. |
| rplN protein network | https://string-db.org/network/866895.HBHAL_1140 | 50S ribosomal protein L14; Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome; Belongs to the universal ribosomal protein uL14 family. |
| rplX protein network | https://string-db.org/network/866895.HBHAL_1141 | 50S ribosomal protein L24; One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit. |
| rplE protein network | https://string-db.org/network/866895.HBHAL_1142 | 50S ribosomal protein L5; This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance [...] |
| rpsZ protein network | https://string-db.org/network/866895.HBHAL_1143 | 30S ribosomal protein S14 type Z; Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site. |
| rpsH protein network | https://string-db.org/network/866895.HBHAL_1144 | 30S ribosomal protein S8; One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit; Belongs to [...] |
| rplF protein network | https://string-db.org/network/866895.HBHAL_1145 | 50S ribosomal protein L6; This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the t [...] |
| rplR protein network | https://string-db.org/network/866895.HBHAL_1146 | 50S ribosomal protein L18; This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protubera [...] |
| rpsE protein network | https://string-db.org/network/866895.HBHAL_1147 | 30S ribosomal protein S5; Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body. Belongs to the universal ribosomal protein uS5 fam [...] |
| rpmD protein network | https://string-db.org/network/866895.HBHAL_1148 | 50S ribosomal protein L30. |
| rplO protein network | https://string-db.org/network/866895.HBHAL_1149 | 50S ribosomal protein L15; Binds to the 23S rRNA; Belongs to the universal ribosomal protein uL15 family. |
| secY protein network | https://string-db.org/network/866895.HBHAL_1150 | Preprotein translocase subunit SecY; The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at t [...] |
| adk protein network | https://string-db.org/network/866895.HBHAL_1151 | Adenylate kinase; Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolis [...] |
| map1 protein network | https://string-db.org/network/866895.HBHAL_1152 | Methionine aminopeptidase; Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharg [...] |
| CCG43534.1 protein network | https://string-db.org/network/866895.HBHAL_1153 | Hypothetical protein. |
| infA protein network | https://string-db.org/network/866895.HBHAL_1154 | Translation initiation factor IF-1; One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl- [...] |
| rpmJ protein network | https://string-db.org/network/866895.HBHAL_1155 | 50S ribosomal protein L36; Belongs to the bacterial ribosomal protein bL36 family. |
| rpsM protein network | https://string-db.org/network/866895.HBHAL_1156 | 30S ribosomal protein S13; Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 [...] |
| rpsK protein network | https://string-db.org/network/866895.HBHAL_1157 | 30S ribosomal protein S11; Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine- Dalgarno cleft in the 70S ribosome; Belon [...] |
| rpoA protein network | https://string-db.org/network/866895.HBHAL_1158 | DNA-directed RNA polymerase alpha subunit; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. |
| rplQ protein network | https://string-db.org/network/866895.HBHAL_1159 | 50S ribosomal protein L17. |
| ecfA protein network | https://string-db.org/network/866895.HBHAL_1160 | ABC-type transport system ATP-binding protein (probable substrate cobalt/nickel); ATP-binding (A) component of a common energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC tr [...] |
| ecfA-2 protein network | https://string-db.org/network/866895.HBHAL_1161 | ABC-type transport system ATP-binding protein (probable substrate cobalt/nickel); ATP-binding (A) component of a common energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC tr [...] |
| ecfT protein network | https://string-db.org/network/866895.HBHAL_1162 | ABC-type transport system permease protein (probable substrate cobalt/nickel); Transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transport [...] |
| truA protein network | https://string-db.org/network/866895.HBHAL_1163 | tRNA pseudouridine synthase A; Formation of pseudouridine at positions 38, 39 and 40 in the anticodon stem and loop of transfer RNAs. |
| rplM protein network | https://string-db.org/network/866895.HBHAL_1164 | 50S ribosomal protein L13; This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages [...] |
| rpsI protein network | https://string-db.org/network/866895.HBHAL_1165 | 30S ribosomal protein S9; Belongs to the universal ribosomal protein uS9 family. |
| CCG43547.1 protein network | https://string-db.org/network/866895.HBHAL_1166 | Hypothetical protein. |
| CCG43548.1 protein network | https://string-db.org/network/866895.HBHAL_1167 | Hypothetical protein. |
| cwlD protein network | https://string-db.org/network/866895.HBHAL_1168 | N-acetylmuramoyl-L-alanine amidase. |
| CCG43550.1 protein network | https://string-db.org/network/866895.HBHAL_1169 | ATP-binding Mrp-like protein; Binds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP; Belongs to the Mrp/NBP35 ATP-binding proteins family. |
| CCG43551.1 protein network | https://string-db.org/network/866895.HBHAL_1170 | Spore germination protein. |
| kbaA protein network | https://string-db.org/network/866895.HBHAL_1171 | KinB signaling pathway activation protein. |
| CCG43553.1 protein network | https://string-db.org/network/866895.HBHAL_1172 | Polysaccharide deacetylase. |
| CCG43554.1 protein network | https://string-db.org/network/866895.HBHAL_1173 | Hypothetical protein. |
| rocF protein network | https://string-db.org/network/866895.HBHAL_1176 | Arginase; Belongs to the arginase family. |
| CCG43556.1 protein network | https://string-db.org/network/866895.HBHAL_1177 | Hypothetical protein. |
| sigW protein network | https://string-db.org/network/866895.HBHAL_1178 | RNA polymerase sigma factor SigW; Belongs to the sigma-70 factor family. ECF subfamily. |
| ybbM protein network | https://string-db.org/network/866895.HBHAL_1179 | Hypothetical protein. |
| ybbP protein network | https://string-db.org/network/866895.HBHAL_1180 | Hypothetical protein; Catalyzes the condensation of 2 ATP molecules into cyclic di- AMP (c-di-AMP), a second messenger used to regulate differing processes in different bacteria. |
| ybbR protein network | https://string-db.org/network/866895.HBHAL_1181 | Hypothetical protein. |
| glmM protein network | https://string-db.org/network/866895.HBHAL_1182 | Phosphoglucosamine mutase; Catalyzes the conversion of glucosamine-6-phosphate to glucosamine-1-phosphate; Belongs to the phosphohexose mutase family. |
| glmS protein network | https://string-db.org/network/866895.HBHAL_1183 | Glucosamine--fructose-6-phosphate aminotransferase; Catalyzes the first step in hexosamine metabolism, converting fructose-6P into glucosamine-6P using glutamine as a nitrogen source. |
| CCG43563.1 protein network | https://string-db.org/network/866895.HBHAL_1184 | Thioredoxin-disulfide reductase. |
| CCG43564.1 protein network | https://string-db.org/network/866895.HBHAL_1185 | M24 family peptidase. |
| CCG43565.1 protein network | https://string-db.org/network/866895.HBHAL_1186 | GntR family transcription regulator. |
| yfhO protein network | https://string-db.org/network/866895.HBHAL_1187 | Hypothetical protein. |
| CCG43567.1 protein network | https://string-db.org/network/866895.HBHAL_1188 | Hypothetical protein. |
| csbB protein network | https://string-db.org/network/866895.HBHAL_1189 | Probable glycosyltransferase CsbB. |
| CCG43569.1 protein network | https://string-db.org/network/866895.HBHAL_1190 | Putative esterase. |
| CCG43570.1 protein network | https://string-db.org/network/866895.HBHAL_1191 | MutT/NUDIX family protein; Belongs to the Nudix hydrolase family. |
| flaR protein network | https://string-db.org/network/866895.HBHAL_1193 | Locus_tag: HBHAL_1192; product: acetyltransferase, GNAT family (nonfunctional); gene has an in-frame stop codon; conceptual translation after in silico reconstruction: MLNSWKGSPIYLREIVEEDWQTVHSYA [...] |
| CCG43573.1 protein network | https://string-db.org/network/866895.HBHAL_1194 | ABC-type transport system ATP-binding/permease protein. |
| CCG43574.1 protein network | https://string-db.org/network/866895.HBHAL_1195 | ABC-type transport system ATP-binding/permease protein. |
| CCG43575.1 protein network | https://string-db.org/network/866895.HBHAL_1196 | Hypothetical protein. |
| CCG43576.1 protein network | https://string-db.org/network/866895.HBHAL_1197 | Metallo-beta-lactamase family protein. |
| CCG43577.1 protein network | https://string-db.org/network/866895.HBHAL_1198 | Hypothetical protein. |
| CCG43578.1 protein network | https://string-db.org/network/866895.HBHAL_1199 | Oxidoreductase, DadA family. |
| CCG43579.1 protein network | https://string-db.org/network/866895.HBHAL_1200 | Glyoxalase domain protein. |
| CCG43580.1 protein network | https://string-db.org/network/866895.HBHAL_1201 | ThiJ/PfpI domain protein. |
| CCG43581.1 protein network | https://string-db.org/network/866895.HBHAL_1202 | ArsR family transcription regulator. |
| CCG43582.1 protein network | https://string-db.org/network/866895.HBHAL_1203 | Cation-transporting ATPase (probable substrate cadmium). |
| murE-2 protein network | https://string-db.org/network/866895.HBHAL_1204 | UDP-N-acetylmuramyl-tripeptide synthetase; Catalyzes the addition of an amino acid to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanyl-D-glutamate (UMAG) in the biosynthesis of bacterial ce [...] |
| CCG43584.1 protein network | https://string-db.org/network/866895.HBHAL_1205 | Hypothetical protein. |
| CCG43585.1 protein network | https://string-db.org/network/866895.HBHAL_1206 | Bifunctional riboflavin kinase / FMN adenylyltransferase; Belongs to the ribF family. |
| CCG43586.1 protein network | https://string-db.org/network/866895.HBHAL_1207 | Conserved hypothetical protein. |
| CCG43587.1 protein network | https://string-db.org/network/866895.HBHAL_1208 | Hypothetical protein. |
| CCG43588.1 protein network | https://string-db.org/network/866895.HBHAL_1210 | IS150-type transposase orfAB. |
| CCG43589.1 protein network | https://string-db.org/network/866895.HBHAL_1211 | Conserved hypothetical protein. |
| CCG43590.1 protein network | https://string-db.org/network/866895.HBHAL_1212 | Hypothetical protein. |
| CCG43591.1 protein network | https://string-db.org/network/866895.HBHAL_1213 | Aldo/keto reductase family protein. |
| CCG43592.1 protein network | https://string-db.org/network/866895.HBHAL_1214 | Methyl-accepting chemotaxis protein. |
| CCG43593.1 protein network | https://string-db.org/network/866895.HBHAL_1215 | Hypothetical protein. |
| uvsE1 protein network | https://string-db.org/network/866895.HBHAL_1217 | UV damage endonuclease; Component in a DNA repair pathway. Removal of UV-light damaged nucleotides. Recognizes pyrimidine dimers and cleave a phosphodiester bond immediately 5' to the lesion. |
| guaD protein network | https://string-db.org/network/866895.HBHAL_1218 | Guanine deaminase. |
| CCG43596.1 protein network | https://string-db.org/network/866895.HBHAL_1219 | CDP-alcohol phosphatidyltransferase; Belongs to the CDP-alcohol phosphatidyltransferase class-I family. |
| CCG43597.1 protein network | https://string-db.org/network/866895.HBHAL_1220 | Cell wall hydrolase. |
| CCG43598.1 protein network | https://string-db.org/network/866895.HBHAL_1221 | Alanine or glycine/cation symporter (AGCS) family protein. |
| CCG43599.1 protein network | https://string-db.org/network/866895.HBHAL_1222 | Hypothetical protein. |
| CCG43600.1 protein network | https://string-db.org/network/866895.HBHAL_1223 | Hypothetical protein. |
| ilvB1 protein network | https://string-db.org/network/866895.HBHAL_1224 | Acetolactate synthase large subunit; Belongs to the TPP enzyme family. |
| CCG43602.1 protein network | https://string-db.org/network/866895.HBHAL_1225 | Diguanylate cyclase domain protein / diguanylate phosphodiesterase domain protein. |
| CCG43603.1 protein network | https://string-db.org/network/866895.HBHAL_1226 | Group II intron reverse transcriptase/maturase. |
| CCG43604.1 protein network | https://string-db.org/network/866895.HBHAL_1227 | ABC-type transport system extracellular binding protein (probable substrate ferrichrome). |
| CCG43605.1 protein network | https://string-db.org/network/866895.HBHAL_1228 | ABC-type transport system permease protein (probable substrate ferrichrome); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily. |
| CCG43606.1 protein network | https://string-db.org/network/866895.HBHAL_1229 | ABC-type transport system permease protein (probable substrate ferrichrome); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily. |
| CCG43607.1 protein network | https://string-db.org/network/866895.HBHAL_1230 | ferredoxin--NADP reductase. |
| CCG43608.1 protein network | https://string-db.org/network/866895.HBHAL_1231 | Conserved hypothetical protein. |
| glsA1 protein network | https://string-db.org/network/866895.HBHAL_1232 | Glutaminase; Belongs to the glutaminase family. |
| ythB protein network | https://string-db.org/network/866895.HBHAL_1233 | Cytochrome d ubiquinol oxidase subunit II. |
| ythA protein network | https://string-db.org/network/866895.HBHAL_1234 | Cytochrome d ubiquinol oxidase subunit I. |
| CCG43612.1 protein network | https://string-db.org/network/866895.HBHAL_1235 | Methyltransferase. |
| ileS protein network | https://string-db.org/network/866895.HBHAL_1236 | isoleucyl-tRNA synthetase; Catalyzes the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such e [...] |
| CCG43614.1 protein network | https://string-db.org/network/866895.HBHAL_1237 | YqiR family transcription regulator. |
| CCG43615.1 protein network | https://string-db.org/network/866895.HBHAL_1238 | Hypothetical protein. |
| CCG43616.1 protein network | https://string-db.org/network/866895.HBHAL_1239 | 4-aminobutyrate aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. |
| CCG43618.1 protein network | https://string-db.org/network/866895.HBHAL_1241 | Conserved hypothetical protein. |
| nadA protein network | https://string-db.org/network/866895.HBHAL_1242 | Quinolinate synthetase; Catalyzes the condensation of iminoaspartate with dihydroxyacetone phosphate to form quinolinate. |
| nadC protein network | https://string-db.org/network/866895.HBHAL_1243 | Nicotinate-nucleotide pyrophosphorylase; Belongs to the NadC/ModD family. |
| nadB protein network | https://string-db.org/network/866895.HBHAL_1244 | L-aspartate oxidase; Catalyzes the oxidation of L-aspartate to iminoaspartate. |
| CCG43622.1 protein network | https://string-db.org/network/866895.HBHAL_1245 | Cysteine desulfurase. |
| CCG43623.1 protein network | https://string-db.org/network/866895.HBHAL_1246 | TrkH family transporter (probable function potassium uptake). |
| CCG43624.1 protein network | https://string-db.org/network/866895.HBHAL_1247 | ABC-type transport system ATP-binding protein (probable substrate ferrichrome). |
| mscL protein network | https://string-db.org/network/866895.HBHAL_1248 | Large-conductance mechanosensitive channel; Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within th [...] |
| CCG43627.1 protein network | https://string-db.org/network/866895.HBHAL_1250 | Hypothetical protein. |
| CCG43628.1 protein network | https://string-db.org/network/866895.HBHAL_1251 | MFS-type transporter (probable function multidrug resistance protein). |
| yphP protein network | https://string-db.org/network/866895.HBHAL_1252 | Hypothetical protein; Belongs to the UPF0403 family. |
| ypgR protein network | https://string-db.org/network/866895.HBHAL_1253 | Hypothetical protein. |
| CCG43631.1 protein network | https://string-db.org/network/866895.HBHAL_1254 | ABC-type transport system ATP-binding protein. |
| CCG43632.1 protein network | https://string-db.org/network/866895.HBHAL_1255 | Probable ABC-type transport system permease protein. |
| CCG43633.1 protein network | https://string-db.org/network/866895.HBHAL_1256 | Conserved hypothetical protein. |
| CCG43634.1 protein network | https://string-db.org/network/866895.HBHAL_1257 | Hypothetical protein. |
| CCG43635.1 protein network | https://string-db.org/network/866895.HBHAL_1258 | Hypothetical protein. |
| CCG43636.1 protein network | https://string-db.org/network/866895.HBHAL_1259 | Formate/nitrite transporter. |
| ygaJ protein network | https://string-db.org/network/866895.HBHAL_1260 | S51 family peptidase; Belongs to the peptidase S51 family. |
| CCG43638.1 protein network | https://string-db.org/network/866895.HBHAL_1261 | Hypothetical protein. |
| CCG43639.1 protein network | https://string-db.org/network/866895.HBHAL_1262 | Hypothetical protein. |
| mta protein network | https://string-db.org/network/866895.HBHAL_1263 | GlnR/MerR family transcription regulator Mta. |
| CCG43641.1 protein network | https://string-db.org/network/866895.HBHAL_1264 | Hypothetical protein. |
| CCG43642.1 protein network | https://string-db.org/network/866895.HBHAL_1265 | Hypothetical protein. |
| yocH2 protein network | https://string-db.org/network/866895.HBHAL_1266 | Conserved hypothetical protein. |
| yocH3 protein network | https://string-db.org/network/866895.HBHAL_1267 | Conserved hypothetical protein. |
| yocH4 protein network | https://string-db.org/network/866895.HBHAL_1268 | Conserved hypothetical protein. |
| CCG43646.1 protein network | https://string-db.org/network/866895.HBHAL_1269 | NADPH-dependent FMN reductase. |
| CCG43647.1 protein network | https://string-db.org/network/866895.HBHAL_1270 | Acetyltransferase, GNAT family. |
| CCG43648.1 protein network | https://string-db.org/network/866895.HBHAL_1271 | Hypothetical protein. |
| CCG43649.1 protein network | https://string-db.org/network/866895.HBHAL_1272 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| CCG43650.1 protein network | https://string-db.org/network/866895.HBHAL_1273 | Hypothetical protein. |
| CCG43651.1 protein network | https://string-db.org/network/866895.HBHAL_1274 | UPF0118 family protein. |
| yubC protein network | https://string-db.org/network/866895.HBHAL_1275 | Hypothetical protein. |
| CCG43653.1 protein network | https://string-db.org/network/866895.HBHAL_1276 | Probable drug/metabolite exporter. |
| CCG43654.1 protein network | https://string-db.org/network/866895.HBHAL_1277 | Acetyltransferase, GNAT family. |
| CCG43655.1 protein network | https://string-db.org/network/866895.HBHAL_1278 | Hypothetical protein. |
| CCG43656.1 protein network | https://string-db.org/network/866895.HBHAL_1279 | LysR family transcription regulator; Belongs to the LysR transcriptional regulatory family. |
| CCG43657.1 protein network | https://string-db.org/network/866895.HBHAL_1280 | Hypothetical protein. |
| CCG43658.1 protein network | https://string-db.org/network/866895.HBHAL_1281 | Hypothetical protein. |
| CCG43659.1 protein network | https://string-db.org/network/866895.HBHAL_1282 | MFS-type transporter. |
| CCG43660.1 protein network | https://string-db.org/network/866895.HBHAL_1283 | LysR family transcription regulator; Belongs to the LysR transcriptional regulatory family. |
| ykjH protein network | https://string-db.org/network/866895.HBHAL_1284 | Conserved hypothetical protein. |
| pfyP protein network | https://string-db.org/network/866895.HBHAL_1285 | Blue-light photoreceptor. |
| CCG43663.1 protein network | https://string-db.org/network/866895.HBHAL_1286 | Putative acyl-CoA dehydrogenase. |
| CCG43664.1 protein network | https://string-db.org/network/866895.HBHAL_1287 | IS150-type transposase orfAB. |
| yraA protein network | https://string-db.org/network/866895.HBHAL_1289 | Intracellular protease, PfpI family. |
| CCG43666.1 protein network | https://string-db.org/network/866895.HBHAL_1290 | Conserved hypothetical protein. |
| CCG43667.1 protein network | https://string-db.org/network/866895.HBHAL_1291 | Hypothetical protein. |
| CCG43668.1 protein network | https://string-db.org/network/866895.HBHAL_1292 | AB hydrolase superfamily protein. |
| sco2 protein network | https://string-db.org/network/866895.HBHAL_1293 | Cytochrome c oxidase assembly protein Sco. |
| yvaM protein network | https://string-db.org/network/866895.HBHAL_1294 | AB hydrolase superfamily protein. |
| CCG43671.1 protein network | https://string-db.org/network/866895.HBHAL_1295 | Hypothetical protein. |
| CCG43672.1 protein network | https://string-db.org/network/866895.HBHAL_1296 | Hypothetical protein. |
| CCG43673.1 protein network | https://string-db.org/network/866895.HBHAL_1297 | Hypothetical protein. |
| CCG43674.1 protein network | https://string-db.org/network/866895.HBHAL_1298 | Hypothetical protein. |
| CCG43675.1 protein network | https://string-db.org/network/866895.HBHAL_1299 | Alpha/beta fold hydrolase. |
| CCG43676.1 protein network | https://string-db.org/network/866895.HBHAL_1300 | Hypothetical protein. |
| CCG43677.1 protein network | https://string-db.org/network/866895.HBHAL_1301 | Hypothetical protein. |
| CCG43678.1 protein network | https://string-db.org/network/866895.HBHAL_1302 | MutT/NUDIX family protein. |
| metB1 protein network | https://string-db.org/network/866895.HBHAL_1303 | Cystathionine gamma-synthase. |
| CCG43680.1 protein network | https://string-db.org/network/866895.HBHAL_1304 | Dicarboxylate/amino acid/cation symporter (DAACS) family protein; Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. |
| CCG43681.1 protein network | https://string-db.org/network/866895.HBHAL_1305 | RNA polymerase sigma-24 subunit, ECF subfamily; Belongs to the sigma-70 factor family. ECF subfamily. |
| CCG43682.1 protein network | https://string-db.org/network/866895.HBHAL_1306 | Hypothetical protein. |
| CCG43683.1 protein network | https://string-db.org/network/866895.HBHAL_1307 | Hypothetical protein. |
| CCG43684.1 protein network | https://string-db.org/network/866895.HBHAL_1308 | Hypothetical protein. |
| CCG43685.1 protein network | https://string-db.org/network/866895.HBHAL_1309 | TetR family transcription regulator. |
| CCG43686.1 protein network | https://string-db.org/network/866895.HBHAL_1310 | NADPH--cytochrome P450 oxidoreductase. |
| CCG43687.1 protein network | https://string-db.org/network/866895.HBHAL_1311 | Hypothetical protein. |
| CCG43688.1 protein network | https://string-db.org/network/866895.HBHAL_1312 | Homolog to isoprenylcysteine carboxyl methyltransferase. |
| CCG43689.1 protein network | https://string-db.org/network/866895.HBHAL_1313 | Phytoene desaturase. |
| CCG43690.1 protein network | https://string-db.org/network/866895.HBHAL_1314 | Na+/Ca2+ antiporter family protein. |
| CCG43691.1 protein network | https://string-db.org/network/866895.HBHAL_1315 | Conserved hypothetical protein. |
| CCG43692.1 protein network | https://string-db.org/network/866895.HBHAL_1317 | uracil-DNA glycosylase family protein. |
| CCG43693.1 protein network | https://string-db.org/network/866895.HBHAL_1318 | Hypothetical protein. |
| CCG43694.1 protein network | https://string-db.org/network/866895.HBHAL_1319 | Hypothetical protein. |
| nrdB protein network | https://string-db.org/network/866895.HBHAL_1320 | Ribonucleotide-diphosphate reductase beta subunit; Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides; [...] |
| nrdA protein network | https://string-db.org/network/866895.HBHAL_1321 | Ribonucleotide-diphosphate reductase alpha subunit; Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. |
| CCG43697.1 protein network | https://string-db.org/network/866895.HBHAL_1322 | Methyltransferase. |
| CCG43698.1 protein network | https://string-db.org/network/866895.HBHAL_1324 | Conserved hypothetical protein. |
| ydaG protein network | https://string-db.org/network/866895.HBHAL_1325 | Conserved hypothetical protein. |
| CCG43700.1 protein network | https://string-db.org/network/866895.HBHAL_1326 | Cation efflux system protein, CDF family. |
| CCG43701.1 protein network | https://string-db.org/network/866895.HBHAL_1327 | Conserved hypothetical protein. |
| CCG43702.1 protein network | https://string-db.org/network/866895.HBHAL_1328 | Acetyltransferase, GNAT family. |
| CCG43703.1 protein network | https://string-db.org/network/866895.HBHAL_1329 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| CCG43704.1 protein network | https://string-db.org/network/866895.HBHAL_1330 | Aminotransferase. |
| CCG43705.1 protein network | https://string-db.org/network/866895.HBHAL_1331 | FAD-dependent oxidoreductase. |
| nos protein network | https://string-db.org/network/866895.HBHAL_1332 | Nitric-oxide synthase oxygenase subunit; Catalyzes the production of nitric oxide. Belongs to the NOS family. Bacterial NOS oxygenase subfamily. |
| CCG43707.1 protein network | https://string-db.org/network/866895.HBHAL_1333 | Carbon-nitrogen hydrolase family protein. |
| CCG43708.1 protein network | https://string-db.org/network/866895.HBHAL_1334 | Two-component sensor histidine kinase. |
| CCG43709.1 protein network | https://string-db.org/network/866895.HBHAL_1335 | Two-component response regulator, LytT family protein. |
| cstA1 protein network | https://string-db.org/network/866895.HBHAL_1336 | Carbon starvation protein CstA. |
| CCG43711.1 protein network | https://string-db.org/network/866895.HBHAL_1337 | Hypothetical protein. |
| CCG43712.1 protein network | https://string-db.org/network/866895.HBHAL_1338 | Probable lipid kinase (homolog to diacylglycerol kinase). |
| yjbJ protein network | https://string-db.org/network/866895.HBHAL_1340 | Transglycosylase domain protein. |
| CCG43715.1 protein network | https://string-db.org/network/866895.HBHAL_1341 | NADH-dependent FMN reductase. |
| CCG43716.1 protein network | https://string-db.org/network/866895.HBHAL_1342 | Hypothetical protein. |
| ohrB protein network | https://string-db.org/network/866895.HBHAL_1343 | Organic hydroperoxide resistance protein. |
| CCG43718.1 protein network | https://string-db.org/network/866895.HBHAL_1344 | Hypothetical protein. |
| CCG43719.1 protein network | https://string-db.org/network/866895.HBHAL_1345 | Hypothetical protein. |
| CCG43720.1 protein network | https://string-db.org/network/866895.HBHAL_1346 | Hypothetical protein. |
| CCG43721.1 protein network | https://string-db.org/network/866895.HBHAL_1347 | IS1341-type transposase. |
| CCG43722.1 protein network | https://string-db.org/network/866895.HBHAL_1349 | Hypothetical protein. |
| CCG43723.1 protein network | https://string-db.org/network/866895.HBHAL_1350 | BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family. |
| CCG43724.1 protein network | https://string-db.org/network/866895.HBHAL_1351 | Acetyltransferase, GNAT family. |
| CCG43725.1 protein network | https://string-db.org/network/866895.HBHAL_1352 | Hypothetical protein. |
| CCG43726.1 protein network | https://string-db.org/network/866895.HBHAL_1353 | Conserved hypothetical protein. |
| CCG43727.1 protein network | https://string-db.org/network/866895.HBHAL_1354 | BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family. |
| CCG43728.1 protein network | https://string-db.org/network/866895.HBHAL_1355 | Conserved hypothetical protein. |
| trxA2 protein network | https://string-db.org/network/866895.HBHAL_1356 | Thioredoxin. |
| CCG43730.1 protein network | https://string-db.org/network/866895.HBHAL_1357 | IS150-type transposase orfAB. |
| CCG43731.1 protein network | https://string-db.org/network/866895.HBHAL_1359 | Pyridine nucleotide-disulfide oxidoreductase family protein. |
| CCG43732.1 protein network | https://string-db.org/network/866895.HBHAL_1360 | DedA family protein. |
| CCG43733.1 protein network | https://string-db.org/network/866895.HBHAL_1361 | ABC-type transport system ATP-binding protein. |
| CCG43734.1 protein network | https://string-db.org/network/866895.HBHAL_1362 | ABC-type transport system permease protein. |
| CCG43735.1 protein network | https://string-db.org/network/866895.HBHAL_1363 | ABC-type transport system permease protein. |
| CCG43736.1 protein network | https://string-db.org/network/866895.HBHAL_1364 | ABC-type transport system extracellular binding protein. |
| ydaC protein network | https://string-db.org/network/866895.HBHAL_1365 | Conserved hypothetical protein. |
| CCG43739.1 protein network | https://string-db.org/network/866895.HBHAL_1367 | Luciferase family oxidoreductase. |
| CCG43740.1 protein network | https://string-db.org/network/866895.HBHAL_1368 | Conserved hypothetical protein. |
| CCG43741.1 protein network | https://string-db.org/network/866895.HBHAL_1369 | Conserved hypothetical protein. |
| CCG43742.1 protein network | https://string-db.org/network/866895.HBHAL_1370 | MATE efflux family protein. |
| CCG43743.1 protein network | https://string-db.org/network/866895.HBHAL_1371 | MarR family transcription regulator. |
| CCG43744.1 protein network | https://string-db.org/network/866895.HBHAL_1372 | Conserved hypothetical protein. |
| CCG43745.1 protein network | https://string-db.org/network/866895.HBHAL_1373 | Hypothetical protein. |
| CCG43746.1 protein network | https://string-db.org/network/866895.HBHAL_1374 | Hypothetical protein. |
| CCG43747.1 protein network | https://string-db.org/network/866895.HBHAL_1375 | Hypothetical protein. |
| bmrU protein network | https://string-db.org/network/866895.HBHAL_1376 | Probable lipid kinase BmrU. |
| CCG43749.1 protein network | https://string-db.org/network/866895.HBHAL_1377 | Probable methyltransferase. |
| mhqR protein network | https://string-db.org/network/866895.HBHAL_1378 | MarR family transcription regulator. |
| CCG43751.1 protein network | https://string-db.org/network/866895.HBHAL_1379 | Hypothetical protein. |
| CCG43752.1 protein network | https://string-db.org/network/866895.HBHAL_1380 | ABC-type transport system ATP-binding protein. |
| CCG43753.1 protein network | https://string-db.org/network/866895.HBHAL_1381 | Hypothetical protein. |
| CCG43754.1 protein network | https://string-db.org/network/866895.HBHAL_1382 | Hypothetical protein. |
| CCG43755.1 protein network | https://string-db.org/network/866895.HBHAL_1383 | Hypothetical protein. |
| CCG43756.1 protein network | https://string-db.org/network/866895.HBHAL_1384 | Alpha/beta fold hydrolase. |
| CCG43757.1 protein network | https://string-db.org/network/866895.HBHAL_1385 | MFS-type transporter. |
| ykuN protein network | https://string-db.org/network/866895.HBHAL_1386 | Flavodoxin. |
| degV4 protein network | https://string-db.org/network/866895.HBHAL_1387 | DegV family protein. |
| CCG43760.1 protein network | https://string-db.org/network/866895.HBHAL_1388 | Hypothetical protein. |
| cshA protein network | https://string-db.org/network/866895.HBHAL_1389 | DEAD-box ATP-dependent RNA helicase CshA; Belongs to the DEAD box helicase family. |
| CCG43762.1 protein network | https://string-db.org/network/866895.HBHAL_1390 | S54 family peptidase. |
| acpS protein network | https://string-db.org/network/866895.HBHAL_1391 | Holo-(acyl carrier protein) synthase; Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein; Belongs to the P-Pant transferase superfamily. AcpS family. |
| nnrD protein network | https://string-db.org/network/866895.HBHAL_1392 | Hypothetical protein; Bifunctional enzyme that catalyzes the epimerization of the S- and R-forms of NAD(P)HX and the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converte [...] |
| ydcC protein network | https://string-db.org/network/866895.HBHAL_1393 | Hypothetical protein. |
| alr1 protein network | https://string-db.org/network/866895.HBHAL_1394 | Alanine racemase; Catalyzes the interconversion of L-alanine and D-alanine. May also act on other amino acids; Belongs to the alanine racemase family. |
| ndoAI protein network | https://string-db.org/network/866895.HBHAL_1395 | Antitoxin EndoAI. |
| ndoA protein network | https://string-db.org/network/866895.HBHAL_1396 | mRNA interferase EndoA; Toxic component of a type II toxin-antitoxin (TA) system. |
| rsbR3 protein network | https://string-db.org/network/866895.HBHAL_1397 | RsbR family protein. |
| rsbS protein network | https://string-db.org/network/866895.HBHAL_1398 | Antagonist of RsbT. |
| rsbT protein network | https://string-db.org/network/866895.HBHAL_1399 | Serine/threonine-protein kinase RsbT. |
| CCG43772.1 protein network | https://string-db.org/network/866895.HBHAL_1400 | Indirect positive regulator of sigma-B activity. |
| rsbV protein network | https://string-db.org/network/866895.HBHAL_1401 | anti-sigma-B factor antagonist RsbV; Belongs to the anti-sigma-factor antagonist family. |
| rsbW protein network | https://string-db.org/network/866895.HBHAL_1402 | Serine-protein kinase RsbW; Negative regulator of sigma-B activity. Phosphorylates and inactivates its specific antagonist protein, RsbV. Upon phosphorylation of RsbV, RsbW is released and binds [...] |
| sigB protein network | https://string-db.org/network/866895.HBHAL_1403 | RNA polymerase sigma factor SigB; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. |
| CCG43776.1 protein network | https://string-db.org/network/866895.HBHAL_1404 | Phosphoserine phosphatase. |
| CCG43777.1 protein network | https://string-db.org/network/866895.HBHAL_1405 | Hypothetical protein. |
| ydcK protein network | https://string-db.org/network/866895.HBHAL_1406 | SprT-like protein; Belongs to the SprT family. |
| thiL protein network | https://string-db.org/network/866895.HBHAL_1408 | Thiamine monophosphate kinase; Catalyzes the ATP-dependent phosphorylation of thiamine- monophosphate (TMP) to form thiamine-pyrophosphate (TPP), the active form of vitamin B1; Belongs to the thi [...] |
| CCG43780.1 protein network | https://string-db.org/network/866895.HBHAL_1409 | Conserved hypothetical protein. |
| ydiC protein network | https://string-db.org/network/866895.HBHAL_1410 | M22 family peptidase. |
| rimI protein network | https://string-db.org/network/866895.HBHAL_1411 | Ribosomal-protein-alanine N-acetyltransferase; Acetylates the N-terminal alanine of ribosomal protein S18. |
| gcp protein network | https://string-db.org/network/866895.HBHAL_1412 | O-sialoglycoprotein endopeptidase; Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is involved in t [...] |
| CCG43784.1 protein network | https://string-db.org/network/866895.HBHAL_1413 | ABC-type transport system ATP-binding protein. |
| moaC protein network | https://string-db.org/network/866895.HBHAL_1414 | Molybdenum cofactor biosynthesis protein C; Catalyzes the conversion of (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP); Belongs to the MoaC fami [...] |
| rex protein network | https://string-db.org/network/866895.HBHAL_1415 | Redox-sensing transcriptional repressor Rex; Modulates transcription in response to changes in cellular NADH/NAD(+) redox state. |
| CCG43787.1 protein network | https://string-db.org/network/866895.HBHAL_1416 | Short-chain dehydrogenase/reductase family protein. |
| CCG43788.1 protein network | https://string-db.org/network/866895.HBHAL_1417 | MFS-type transporter (probable function drug:H+ antiporter); Belongs to the major facilitator superfamily. |
| CCG43789.1 protein network | https://string-db.org/network/866895.HBHAL_1418 | Acetyltransferase, GNAT family. |
| CCG43790.1 protein network | https://string-db.org/network/866895.HBHAL_1419 | Hypothetical protein. |
| ydiL protein network | https://string-db.org/network/866895.HBHAL_1420 | Probable membrane peptidase YdiL. |
| groS protein network | https://string-db.org/network/866895.HBHAL_1421 | Co-chaperonin GroES; Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter. |
| groL protein network | https://string-db.org/network/866895.HBHAL_1422 | Chaperonin GroEL; Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions. |
| CCG43794.1 protein network | https://string-db.org/network/866895.HBHAL_1423 | Hypothetical protein. |
| CCG43795.1 protein network | https://string-db.org/network/866895.HBHAL_1424 | Hypothetical protein. |
| CCG43796.1 protein network | https://string-db.org/network/866895.HBHAL_1425 | Hypothetical protein. |
| CCG43797.1 protein network | https://string-db.org/network/866895.HBHAL_1426 | Glucosylceramidase; Belongs to the glycosyl hydrolase 30 family. |
| CCG43798.1 protein network | https://string-db.org/network/866895.HBHAL_1427 | Spore germination protein. |
| CCG43799.1 protein network | https://string-db.org/network/866895.HBHAL_1428 | Spore germination protein XA. |
| CCG43800.1 protein network | https://string-db.org/network/866895.HBHAL_1429 | Spore germination protein. |
| CCG43801.1 protein network | https://string-db.org/network/866895.HBHAL_1430 | Conserved hypothetical protein. |
| CCG43802.1 protein network | https://string-db.org/network/866895.HBHAL_1431 | Putative citrate transporter. |
| CCG43803.1 protein network | https://string-db.org/network/866895.HBHAL_1432 | Conserved hypothetical protein. |
| CCG43804.1 protein network | https://string-db.org/network/866895.HBHAL_1433 | Exopolysaccharide biosynthesis protein. |
| CCG43805.1 protein network | https://string-db.org/network/866895.HBHAL_1434 | Hypothetical protein. |
| CCG43806.1 protein network | https://string-db.org/network/866895.HBHAL_1435 | Conserved hypothetical protein. |
| CCG43807.1 protein network | https://string-db.org/network/866895.HBHAL_1436 | Putative spore coat polysaccharide biosynthesis protein. |
| CCG43808.1 protein network | https://string-db.org/network/866895.HBHAL_1437 | NAD-dependent epimerase/dehydratase family protein. |
| CCG43809.1 protein network | https://string-db.org/network/866895.HBHAL_1437_A | Glutamine--scyllo-inositol aminotransferase; Belongs to the DegT/DnrJ/EryC1 family. |
| CCG43810.1 protein network | https://string-db.org/network/866895.HBHAL_1438 | Putative polysaccharide biosynthesis protein. |
| CCG43811.1 protein network | https://string-db.org/network/866895.HBHAL_1439 | Acetyltransferase, GNAT family. |
| CCG43812.1 protein network | https://string-db.org/network/866895.HBHAL_1440 | N-acylneuraminate-9-phosphate synthase. |
| CCG43813.1 protein network | https://string-db.org/network/866895.HBHAL_1441 | Acylneuraminate cytidylyltransferase. |
| CCG43814.1 protein network | https://string-db.org/network/866895.HBHAL_1442 | General stress protein. |
| yvnB protein network | https://string-db.org/network/866895.HBHAL_1443 | Hypothetical protein. |
| CCG43816.1 protein network | https://string-db.org/network/866895.HBHAL_1444 | Conserved hypothetical protein. |
| CCG43817.1 protein network | https://string-db.org/network/866895.HBHAL_1445 | Hypothetical protein. |
| gbsU protein network | https://string-db.org/network/866895.HBHAL_1446 | ABC-type transport system extracellular binding protein (probable substrate glycine betaine/proline). |
| gbsR protein network | https://string-db.org/network/866895.HBHAL_1447 | YuaC family transcription regulator GbsR; Belongs to the GbsR family. |
| gbsA protein network | https://string-db.org/network/866895.HBHAL_1448 | Glycine betaine aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| CCG43821.1 protein network | https://string-db.org/network/866895.HBHAL_1449 | Hypothetical protein. |
| gbsB protein network | https://string-db.org/network/866895.HBHAL_1450 | Choline dehydrogenase; Involved in the biosynthesis of the osmoprotectant glycine betaine. Catalyzes the oxidation of choline to betaine aldehyde and betaine aldehyde to glycine betaine at the sa [...] |
| ahpF protein network | https://string-db.org/network/866895.HBHAL_1451 | Alkyl hydroperoxide reductase subunit F. |
| CCG43824.1 protein network | https://string-db.org/network/866895.HBHAL_1452 | Peroxiredoxin; Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against [...] |
| CCG43825.1 protein network | https://string-db.org/network/866895.HBHAL_1453 | Prolyl 4-hydroxylase alpha subunit. |
| prs2 protein network | https://string-db.org/network/866895.HBHAL_1454 | Ribose-phosphate pyrophosphokinase; Involved in the biosynthesis of the central metabolite phospho-alpha-D-ribosyl-1-pyrophosphate (PRPP) via the transfer of pyrophosphoryl group from ATP to 1-hy [...] |
| yhfK1 protein network | https://string-db.org/network/866895.HBHAL_1455 | Conserved hypothetical protein. |
| CCG43828.1 protein network | https://string-db.org/network/866895.HBHAL_1456 | Hypothetical protein. |
| CCG43830.1 protein network | https://string-db.org/network/866895.HBHAL_1458 | Hypothetical protein. |
| CCG43831.1 protein network | https://string-db.org/network/866895.HBHAL_1459 | Conserved hypothetical protein. |
| CCG43832.1 protein network | https://string-db.org/network/866895.HBHAL_1460 | Conserved hypothetical protein. |
| CCG43834.1 protein network | https://string-db.org/network/866895.HBHAL_1462 | Conserved hypothetical protein. |
| CCG43835.1 protein network | https://string-db.org/network/866895.HBHAL_1463 | Hypothetical protein. |
| CCG43836.1 protein network | https://string-db.org/network/866895.HBHAL_1464 | Hypothetical protein. |
| CCG43837.1 protein network | https://string-db.org/network/866895.HBHAL_1465 | Hypothetical protein. |
| CCG43838.1 protein network | https://string-db.org/network/866895.HBHAL_1466 | Hypothetical protein. |
| CCG43839.1 protein network | https://string-db.org/network/866895.HBHAL_1467 | Hypothetical protein. |
| CCG43840.1 protein network | https://string-db.org/network/866895.HBHAL_1468 | Hypothetical protein. |
| CCG43841.1 protein network | https://string-db.org/network/866895.HBHAL_1469 | Conserved hypothetical protein. |
| CCG43842.1 protein network | https://string-db.org/network/866895.HBHAL_1470 | GntR family transcription regulator. |
| CCG43843.1 protein network | https://string-db.org/network/866895.HBHAL_1471 | Maltose-6'-phosphate glucosidase. |
| CCG43844.1 protein network | https://string-db.org/network/866895.HBHAL_1472 | PTS system subunit IIA, glucose-specific. |
| CCG43845.1 protein network | https://string-db.org/network/866895.HBHAL_1473 | Hypothetical protein. |
| yjaZ protein network | https://string-db.org/network/866895.HBHAL_1474 | Hypothetical protein. |
| yjcC1 protein network | https://string-db.org/network/866895.HBHAL_1475 | YjcC family transcription regulator. |
| CCG43848.1 protein network | https://string-db.org/network/866895.HBHAL_1476 | Methyltransferase. |
| ycbP protein network | https://string-db.org/network/866895.HBHAL_1477 | Hypothetical protein. |
| ydfS protein network | https://string-db.org/network/866895.HBHAL_1478 | Hypothetical protein. |
| CCG43851.1 protein network | https://string-db.org/network/866895.HBHAL_1479 | AMT family transporter (probable substrate ammonium). |
| CCG43852.1 protein network | https://string-db.org/network/866895.HBHAL_1480 | Conserved hypothetical protein. |
| CCG43853.1 protein network | https://string-db.org/network/866895.HBHAL_1481 | Exonuclease domain protein. |
| CCG43854.1 protein network | https://string-db.org/network/866895.HBHAL_1482 | Hypothetical protein. |
| selO protein network | https://string-db.org/network/866895.HBHAL_1483 | Hypothetical protein; Catalyzes the transfer of adenosine 5'-monophosphate (AMP) to Ser, Thr or Tyr residues of target proteins (AMPylation). Belongs to the SELO family. |
| CCG43856.1 protein network | https://string-db.org/network/866895.HBHAL_1484 | IS1341-type transposase. |
| CCG43857.1 protein network | https://string-db.org/network/866895.HBHAL_1485 | Spore coat protein X. |
| CCG43858.1 protein network | https://string-db.org/network/866895.HBHAL_1486 | Spore coat protein X. |
| CCG43859.1 protein network | https://string-db.org/network/866895.HBHAL_1487 | Hypothetical protein. |
| CCG43860.1 protein network | https://string-db.org/network/866895.HBHAL_1488 | Putative secreted protein. |
| CCG43861.1 protein network | https://string-db.org/network/866895.HBHAL_1489 | Hypothetical protein. |
| CCG43862.1 protein network | https://string-db.org/network/866895.HBHAL_1490 | Glyoxalase/bleomycin resistance protein/dioxygenase. |
| CCG43863.1 protein network | https://string-db.org/network/866895.HBHAL_1491 | Hypothetical protein. |
| CCG43864.1 protein network | https://string-db.org/network/866895.HBHAL_1492 | ZIP family transporter (probable substrate divalent heavy-metal cations). |
| yvbH protein network | https://string-db.org/network/866895.HBHAL_1493 | Hypothetical protein. |
| CCG43866.1 protein network | https://string-db.org/network/866895.HBHAL_1494 | DUF21/CBS domain protein. |
| CCG43867.1 protein network | https://string-db.org/network/866895.HBHAL_1495 | FAD-dependent oxidoreductase. |
| CCG43868.1 protein network | https://string-db.org/network/866895.HBHAL_1497 | IclR family transcription regulator. |
| CCG43869.1 protein network | https://string-db.org/network/866895.HBHAL_1498 | 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase. |
| dgoK protein network | https://string-db.org/network/866895.HBHAL_1499 | 2-keto-3-deoxy-galactonokinase. |
| dgoA protein network | https://string-db.org/network/866895.HBHAL_1500 | Homolog to galactonate dehydratase. |
| CCG43872.1 protein network | https://string-db.org/network/866895.HBHAL_1501 | Hypothetical protein. |
| gntK protein network | https://string-db.org/network/866895.HBHAL_1502 | Gluconate kinase; Belongs to the FGGY kinase family. |
| CCG43874.1 protein network | https://string-db.org/network/866895.HBHAL_1503 | GntP family transporter (probable substrate gluconate). |
| CCG43876.1 protein network | https://string-db.org/network/866895.HBHAL_1505 | TetR family transcription regulator. |
| osmC1 protein network | https://string-db.org/network/866895.HBHAL_1506 | OsmC family protein. |
| CCG43878.1 protein network | https://string-db.org/network/866895.HBHAL_1507 | Metallo-beta-lactamase family protein. |
| CCG43879.1 protein network | https://string-db.org/network/866895.HBHAL_1508 | UPF0721 family protein. |
| CCG43880.1 protein network | https://string-db.org/network/866895.HBHAL_1509 | Conserved hypothetical protein. |
| CCG43881.1 protein network | https://string-db.org/network/866895.HBHAL_1510 | Hypothetical protein. |
| CCG43882.1 protein network | https://string-db.org/network/866895.HBHAL_1511 | Hypothetical protein. |
| CCG43883.1 protein network | https://string-db.org/network/866895.HBHAL_1512 | Allantoate amidohydrolase. |
| pbpC protein network | https://string-db.org/network/866895.HBHAL_1513 | Penicillin-binding protein 3. |
| CCG43886.1 protein network | https://string-db.org/network/866895.HBHAL_1515 | Conserved hypothetical protein / HTH domain protein. |
| CCG43887.1 protein network | https://string-db.org/network/866895.HBHAL_1516 | Hypothetical protein. |
| CCG43888.1 protein network | https://string-db.org/network/866895.HBHAL_1517 | Hypothetical protein. |
| ectA protein network | https://string-db.org/network/866895.HBHAL_1518 | L-2,4-diaminobutyric acid acetyltransferase; Catalyzes the acetylation of L-2,4-diaminobutyrate (DABA) to gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) with acetyl coenzyme A. |
| ectB protein network | https://string-db.org/network/866895.HBHAL_1519 | Diaminobutyrate--2-oxoglutarate aminotransferase; Catalyzes reversively the conversion of L-aspartate beta- semialdehyde (ASA) to L-2,4-diaminobutyrate (DABA) by transamination with L-glutamate; [...] |
| ectC protein network | https://string-db.org/network/866895.HBHAL_1520 | L-ectoine synthase; Catalyzes the circularization of gamma-N-acetyl-alpha,gamma- diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4- pyrimidine carboxylic acid), which is an ex [...] |
| CCG43892.1 protein network | https://string-db.org/network/866895.HBHAL_1522 | Hypothetical protein. |
| CCG43893.1 protein network | https://string-db.org/network/866895.HBHAL_1523 | Hypothetical protein. |
| CCG43894.1 protein network | https://string-db.org/network/866895.HBHAL_1524 | acyl-CoA dehydrogenase. |
| CCG43895.1 protein network | https://string-db.org/network/866895.HBHAL_1525 | Short-chain dehydrogenase/reductase family protein. |
| CCG43896.1 protein network | https://string-db.org/network/866895.HBHAL_1526 | Hypothetical protein. |
| CCG43897.1 protein network | https://string-db.org/network/866895.HBHAL_1527 | MaoC-like dehydratase. |
| CCG43898.1 protein network | https://string-db.org/network/866895.HBHAL_1528 | acyl-CoA dehydrogenase. |
| CCG43899.1 protein network | https://string-db.org/network/866895.HBHAL_1529 | Short-chain dehydrogenase/reductase family protein. |
| CCG43900.1 protein network | https://string-db.org/network/866895.HBHAL_1530 | acetyl-CoA acetyltransferase; Belongs to the thiolase-like superfamily. Thiolase family. |
| CCG43901.1 protein network | https://string-db.org/network/866895.HBHAL_1531 | TetR family transcription regulator. |
| CCG43902.1 protein network | https://string-db.org/network/866895.HBHAL_1532 | Conserved hypothetical protein. |
| CCG43903.1 protein network | https://string-db.org/network/866895.HBHAL_1533 | Short-chain dehydrogenase/reductase family protein. |
| CCG43904.1 protein network | https://string-db.org/network/866895.HBHAL_1534 | long-chain-fatty-acid--CoA ligase. |
| CCG43905.1 protein network | https://string-db.org/network/866895.HBHAL_1535 | ABC-type transport system permease protein (probable substrate branched-chain amino acid); Belongs to the binding-protein-dependent transport system permease family. |
| CCG43906.1 protein network | https://string-db.org/network/866895.HBHAL_1536 | ABC-type transport system permease protein (probable substrate branched-chain amino acid); Belongs to the binding-protein-dependent transport system permease family. |
| CCG43907.1 protein network | https://string-db.org/network/866895.HBHAL_1537 | ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acid). |
| CCG43908.1 protein network | https://string-db.org/network/866895.HBHAL_1538 | ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acid). |
| CCG43909.1 protein network | https://string-db.org/network/866895.HBHAL_1539 | ABC-type transport system substrate-binding protein (probable substrate branched-chain amino acid). |
| CCG43910.1 protein network | https://string-db.org/network/866895.HBHAL_1540 | acyl-CoA dehydrogenase. |
| CCG43911.1 protein network | https://string-db.org/network/866895.HBHAL_1541 | long-chain-fatty-acid--CoA ligase. |
| CCG43912.1 protein network | https://string-db.org/network/866895.HBHAL_1542 | acyl-CoA dehydrogenase. |
| CCG43913.1 protein network | https://string-db.org/network/866895.HBHAL_1543 | acetyl-CoA acetyltransferase; Belongs to the thiolase-like superfamily. Thiolase family. |
| CCG43914.1 protein network | https://string-db.org/network/866895.HBHAL_1544 | Hypothetical protein. |
| CCG43915.1 protein network | https://string-db.org/network/866895.HBHAL_1545 | Thioesterase family protein. |
| CCG43916.1 protein network | https://string-db.org/network/866895.HBHAL_1546 | Hypothetical protein. |
| CCG43917.1 protein network | https://string-db.org/network/866895.HBHAL_1547 | Hypothetical protein. |
| CCG43918.1 protein network | https://string-db.org/network/866895.HBHAL_1548 | AbgT family transporter (probable substrate aminobenzoyl-glutamate). |
| CCG43919.1 protein network | https://string-db.org/network/866895.HBHAL_1549 | Hypothetical protein. |
| CCG43920.1 protein network | https://string-db.org/network/866895.HBHAL_1550 | Allantoate amidohydrolase. |
| CCG43921.1 protein network | https://string-db.org/network/866895.HBHAL_1551 | indole-3-acetyl-L-aspartic acid hydrolase. |
| CCG43922.1 protein network | https://string-db.org/network/866895.HBHAL_1552 | Putative hydrolase. |
| CCG43923.1 protein network | https://string-db.org/network/866895.HBHAL_1553 | TrkA-N domain protein. |
| CCG43924.1 protein network | https://string-db.org/network/866895.HBHAL_1554 | Cold shock protein. |
| CCG43925.1 protein network | https://string-db.org/network/866895.HBHAL_1555 | Cold shock protein. |
| phoB protein network | https://string-db.org/network/866895.HBHAL_1557 | Alkaline phosphatase; Belongs to the alkaline phosphatase family. |
| CCG43927.1 protein network | https://string-db.org/network/866895.HBHAL_1558 | Conserved hypothetical protein. |
| ytwF protein network | https://string-db.org/network/866895.HBHAL_1559 | Rhodanese domain protein. |
| CCG43929.1 protein network | https://string-db.org/network/866895.HBHAL_1560 | Polysaccharide deacetylase family protein. |
| CCG43930.1 protein network | https://string-db.org/network/866895.HBHAL_1561 | Hypothetical protein. |
| CCG43931.1 protein network | https://string-db.org/network/866895.HBHAL_1562 | ABC-type transport system extracellular binding protein (probable substrate amino acid); Belongs to the bacterial solute-binding protein 3 family. |
| CCG43932.1 protein network | https://string-db.org/network/866895.HBHAL_1563 | ABC-type transport system permease protein (probable substrate amino acid). |
| CCG43933.1 protein network | https://string-db.org/network/866895.HBHAL_1564 | ABC-type transport system ATP-binding protein (probable substrate amino acid). |
| CCG43934.1 protein network | https://string-db.org/network/866895.HBHAL_1565 | Hypothetical protein. |
| CCG43935.1 protein network | https://string-db.org/network/866895.HBHAL_1566 | Hypothetical protein. |
| CCG43936.1 protein network | https://string-db.org/network/866895.HBHAL_1567 | Hypothetical protein. |
| CCG43937.1 protein network | https://string-db.org/network/866895.HBHAL_1568 | Glyoxalase domain protein. |
| CCG43938.1 protein network | https://string-db.org/network/866895.HBHAL_1569 | Hypothetical protein. |
| ccdA1 protein network | https://string-db.org/network/866895.HBHAL_1570 | Cytochrome c biogenesis protein CcdA. |
| yneN protein network | https://string-db.org/network/866895.HBHAL_1571 | Homolog to thioredoxin. |
| CCG43941.1 protein network | https://string-db.org/network/866895.HBHAL_1572 | Two-component response regulator, OmpR family protein. |
| CCG43942.1 protein network | https://string-db.org/network/866895.HBHAL_1573 | Two-component sensor histidine kinase. |
| sodC1 protein network | https://string-db.org/network/866895.HBHAL_1574 | Superoxide dismutase (Cu/Zn). |
| CCG43944.1 protein network | https://string-db.org/network/866895.HBHAL_1575 | Glutathione-dependent formaldehyde dehydrogenase. |
| CCG43945.1 protein network | https://string-db.org/network/866895.HBHAL_1576 | Hypothetical protein. |
| yndN protein network | https://string-db.org/network/866895.HBHAL_1577 | Fosfomycin resistance protein FosB; Metallothiol transferase which confers resistance to fosfomycin by catalyzing the addition of a thiol cofactor to fosfomycin. L-cysteine is probably the physio [...] |
| CCG43947.1 protein network | https://string-db.org/network/866895.HBHAL_1578 | NRAMP family transporter (probable substrate Mn2+/Fe2+). |
| CCG43948.1 protein network | https://string-db.org/network/866895.HBHAL_1579 | Carbohydrate kinase; Belongs to the FGGY kinase family. |
| CCG43949.1 protein network | https://string-db.org/network/866895.HBHAL_1580 | Methanol dehydrogenase regulatory protein. |
| yeaD protein network | https://string-db.org/network/866895.HBHAL_1581 | Hypothetical protein. |
| yebA protein network | https://string-db.org/network/866895.HBHAL_1582 | Protease, transglutaminase superfamily. |
| guaA protein network | https://string-db.org/network/866895.HBHAL_1583 | GMP synthase (glutamine-hydrolysing); Catalyzes the synthesis of GMP from XMP. |
| CCG43953.1 protein network | https://string-db.org/network/866895.HBHAL_1584 | Putative MFS-type transporter (probable substrate xanthine/uracil). |
| CCG43954.1 protein network | https://string-db.org/network/866895.HBHAL_1585 | Small heat shock protein; Belongs to the small heat shock protein (HSP20) family. |
| CCG43955.1 protein network | https://string-db.org/network/866895.HBHAL_1586 | UPF0316 family protein. |
| CCG43956.1 protein network | https://string-db.org/network/866895.HBHAL_1587 | Conserved hypothetical protein. |
| purE protein network | https://string-db.org/network/866895.HBHAL_1588 | Phosphoribosylaminoimidazole carboxylase catalytic subunit; Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR). |
| purK protein network | https://string-db.org/network/866895.HBHAL_1589 | Phosphoribosylaminoimidazole carboxylase ATPase subunit; Catalyzes the ATP-dependent conversion of 5-aminoimidazole ribonucleotide (AIR) and HCO(3)(-) to N5-carboxyaminoimidazole ribonucleotide ( [...] |
| purB protein network | https://string-db.org/network/866895.HBHAL_1590 | Adenylosuccinate lyase; Belongs to the lyase 1 family. Adenylosuccinate lyase subfamily. |
| purC protein network | https://string-db.org/network/866895.HBHAL_1591 | Phosphoribosylaminoimidazole-succinocarboxamide synthase; Belongs to the SAICAR synthetase family. |
| purS protein network | https://string-db.org/network/866895.HBHAL_1592 | Phosphoribosylformylglycinamidine synthase subunit PurS; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent c [...] |
| purQ protein network | https://string-db.org/network/866895.HBHAL_1593 | Phosphoribosylformylglycinamidine synthase subunit I; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conv [...] |
| purL protein network | https://string-db.org/network/866895.HBHAL_1594 | Phosphoribosylformylglycinamidine synthase subunit II; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent con [...] |
| purF protein network | https://string-db.org/network/866895.HBHAL_1595 | Amidophosphoribosyltransferase; Catalyzes the formation of phosphoribosylamine from phosphoribosylpyrophosphate (PRPP) and glutamine. |
| purM protein network | https://string-db.org/network/866895.HBHAL_1596 | Phosphoribosylformylglycinamidine cyclo-ligase. |
| purN protein network | https://string-db.org/network/866895.HBHAL_1597 | Phosphoribosylglycinamide formyltransferase; Catalyzes the transfer of a formyl group from 10- formyltetrahydrofolate to 5-phospho-ribosyl-glycinamide (GAR), producing 5-phospho-ribosyl-N-formylg [...] |
| purH protein network | https://string-db.org/network/866895.HBHAL_1598 | Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase. |
| purD protein network | https://string-db.org/network/866895.HBHAL_1599 | Phosphoribosylamine--glycine ligase; Belongs to the GARS family. |
| CCG43969.1 protein network | https://string-db.org/network/866895.HBHAL_1601 | Hypothetical protein. |
| ade1 protein network | https://string-db.org/network/866895.HBHAL_1602 | Adenine deaminase. |
| CCG43971.1 protein network | https://string-db.org/network/866895.HBHAL_1603 | Conserved hypothetical protein. |
| CCG43972.1 protein network | https://string-db.org/network/866895.HBHAL_1604 | Conserved hypothetical protein. |
| thrC1 protein network | https://string-db.org/network/866895.HBHAL_1605 | Threonine synthase. |
| CCG43974.1 protein network | https://string-db.org/network/866895.HBHAL_1606 | Conserved hypothetical protein. |
| pcrB protein network | https://string-db.org/network/866895.HBHAL_1607 | Heptaprenylglyceryl phosphate synthase; Prenyltransferase that catalyzes in vivo the transfer of the heptaprenyl moiety of heptaprenyl pyrophosphate (HepPP; 35 carbon atoms) to the C3 hydroxyl of [...] |
| pcrA1 protein network | https://string-db.org/network/866895.HBHAL_1608 | ATP-dependent DNA helicase PcrA. |
| ligA protein network | https://string-db.org/network/866895.HBHAL_1609 | NAD-dependent DNA ligase LigA; DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double- stranded DNA using NAD as a coenzyme and [...] |
| CCG43978.1 protein network | https://string-db.org/network/866895.HBHAL_1611 | Conserved hypothetical protein. |
| p5cdh1 protein network | https://string-db.org/network/866895.HBHAL_1612 | 1-pyrroline-5-carboxylate dehydrogenase; Belongs to the aldehyde dehydrogenase family. RocA subfamily. |
| CCG43980.1 protein network | https://string-db.org/network/866895.HBHAL_1613 | Conserved hypothetical protein. |
| CCG43981.1 protein network | https://string-db.org/network/866895.HBHAL_1614 | Sodium/proline symporter; Catalyzes the sodium-dependent uptake of extracellular L- proline; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| gatC protein network | https://string-db.org/network/866895.HBHAL_1616 | glutamyl-tRNA amidotransferase subunit C; Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in orga [...] |
| gatA protein network | https://string-db.org/network/866895.HBHAL_1617 | glutamyl-tRNA amidotransferase subunit A; Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA s [...] |
| gatB protein network | https://string-db.org/network/866895.HBHAL_1618 | glutamyl-tRNA amidotransferase subunit B; Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in orga [...] |
| dagK protein network | https://string-db.org/network/866895.HBHAL_1619 | Diacylglycerol kinase. |
| CCG43987.1 protein network | https://string-db.org/network/866895.HBHAL_1620 | RNA methyltransferase; Belongs to the class I-like SAM-binding methyltransferase superfamily. RNA M5U methyltransferase family. |
| CCG43988.1 protein network | https://string-db.org/network/866895.HBHAL_1621 | Phage integrase domain protein; Belongs to the 'phage' integrase family. |
| CCG43989.1 protein network | https://string-db.org/network/866895.HBHAL_1622 | Hypothetical protein. |
| CCG43990.1 protein network | https://string-db.org/network/866895.HBHAL_1623 | Conserved hypothetical protein. |
| CCG43991.1 protein network | https://string-db.org/network/866895.HBHAL_1624 | SinR/xre family transcription regulator. |
| CCG43992.1 protein network | https://string-db.org/network/866895.HBHAL_1625 | HTH domain protein. |
| CCG43993.1 protein network | https://string-db.org/network/866895.HBHAL_1626 | Putative antirepressor. |
| CCG43994.1 protein network | https://string-db.org/network/866895.HBHAL_1627 | Hypothetical protein. |
| CCG43995.1 protein network | https://string-db.org/network/866895.HBHAL_1628 | HTH domain protein. |
| CCG43996.1 protein network | https://string-db.org/network/866895.HBHAL_1629 | DnaD domain protein. |
| CCG43997.1 protein network | https://string-db.org/network/866895.HBHAL_1630 | Conserved hypothetical protein. |
| CCG43998.1 protein network | https://string-db.org/network/866895.HBHAL_1631 | Conserved hypothetical protein. |
| CCG43999.1 protein network | https://string-db.org/network/866895.HBHAL_1632 | Conserved hypothetical protein. |
| CCG44000.1 protein network | https://string-db.org/network/866895.HBHAL_1633 | Conserved hypothetical protein. |
| CCG44001.1 protein network | https://string-db.org/network/866895.HBHAL_1634 | Conserved hypothetical protein. |
| CCG44002.1 protein network | https://string-db.org/network/866895.HBHAL_1635 | Conserved hypothetical protein. |
| CCG44003.1 protein network | https://string-db.org/network/866895.HBHAL_1636 | Conserved hypothetical protein. |
| CCG44004.1 protein network | https://string-db.org/network/866895.HBHAL_1637 | Conserved hypothetical protein. |
| CCG44005.1 protein network | https://string-db.org/network/866895.HBHAL_1638 | Conserved hypothetical protein. |
| CCG44006.1 protein network | https://string-db.org/network/866895.HBHAL_1639 | Conserved hypothetical protein. |
| CCG44007.1 protein network | https://string-db.org/network/866895.HBHAL_1640 | Conserved hypothetical protein. |
| CCG44008.1 protein network | https://string-db.org/network/866895.HBHAL_1641 | Conserved hypothetical protein. |
| CCG44009.1 protein network | https://string-db.org/network/866895.HBHAL_1642 | Conserved hypothetical protein. |
| CCG44010.1 protein network | https://string-db.org/network/866895.HBHAL_1643 | Conserved hypothetical protein. |
| CCG44011.1 protein network | https://string-db.org/network/866895.HBHAL_1644 | Conserved hypothetical protein. |
| CCG44012.1 protein network | https://string-db.org/network/866895.HBHAL_1645 | Conserved hypothetical protein. |
| CCG44013.1 protein network | https://string-db.org/network/866895.HBHAL_1646 | Conserved hypothetical protein. |
| CCG44014.1 protein network | https://string-db.org/network/866895.HBHAL_1647 | Conserved hypothetical protein. |
| CCG44015.1 protein network | https://string-db.org/network/866895.HBHAL_1648 | Conserved hypothetical protein. |
| CCG44016.1 protein network | https://string-db.org/network/866895.HBHAL_1649 | Hypothetical protein. |
| CCG44017.1 protein network | https://string-db.org/network/866895.HBHAL_1650 | Hypothetical protein. |
| CCG44019.1 protein network | https://string-db.org/network/866895.HBHAL_1652 | Hypothetical protein. |
| CCG44020.1 protein network | https://string-db.org/network/866895.HBHAL_1653 | Hypothetical protein. |
| CCG44021.1 protein network | https://string-db.org/network/866895.HBHAL_1654 | Hypothetical protein. |
| CCG44022.1 protein network | https://string-db.org/network/866895.HBHAL_1655 | Hypothetical protein. |
| CCG44023.1 protein network | https://string-db.org/network/866895.HBHAL_1656 | Hypothetical protein. |
| CCG44024.1 protein network | https://string-db.org/network/866895.HBHAL_1657 | Phage integrase domain protein; Belongs to the 'phage' integrase family. |
| CCG44025.1 protein network | https://string-db.org/network/866895.HBHAL_1658 | Hypothetical protein. |
| CCG44026.1 protein network | https://string-db.org/network/866895.HBHAL_1659 | Hypothetical protein. |
| CCG44027.1 protein network | https://string-db.org/network/866895.HBHAL_1660 | Hypothetical protein. |
| CCG44028.1 protein network | https://string-db.org/network/866895.HBHAL_1661 | Hypothetical protein. |
| CCG44029.1 protein network | https://string-db.org/network/866895.HBHAL_1662 | Acetyltransferase, GNAT family. |
| CCG44030.1 protein network | https://string-db.org/network/866895.HBHAL_1663 | Hypothetical protein. |
| CCG44031.1 protein network | https://string-db.org/network/866895.HBHAL_1664 | Hypothetical protein. |
| yckC1 protein network | https://string-db.org/network/866895.HBHAL_1665 | RDD domain protein. |
| CCG44033.1 protein network | https://string-db.org/network/866895.HBHAL_1666 | Conserved hypothetical protein. |
| CCG44034.1 protein network | https://string-db.org/network/866895.HBHAL_1667 | Group II intron reverse transcriptase/maturase. |
| CCG44035.1 protein network | https://string-db.org/network/866895.HBHAL_1668 | Hypothetical protein. |
| CCG44036.1 protein network | https://string-db.org/network/866895.HBHAL_1669 | Hypothetical protein. |
| katG protein network | https://string-db.org/network/866895.HBHAL_1670 | Catalase/peroxidase HPI; Bifunctional enzyme with both catalase and broad-spectrum peroxidase activity; Belongs to the peroxidase family. Peroxidase/catalase subfamily. |
| CCG44038.1 protein network | https://string-db.org/network/866895.HBHAL_1671 | Hypothetical protein. |
| CCG44039.1 protein network | https://string-db.org/network/866895.HBHAL_1672 | Hypothetical protein. |
| CCG44040.1 protein network | https://string-db.org/network/866895.HBHAL_1673 | Hypothetical protein. |
| CCG44041.1 protein network | https://string-db.org/network/866895.HBHAL_1674 | Putative methyltransferase. |
| CCG44042.1 protein network | https://string-db.org/network/866895.HBHAL_1675 | Bile acid/sodium symporter (BASS) family protein. |
| CCG44043.1 protein network | https://string-db.org/network/866895.HBHAL_1676 | Conserved hypothetical protein. |
| CCG44044.1 protein network | https://string-db.org/network/866895.HBHAL_1677 | UvrD/REP helicase family protein. |
| CCG44045.1 protein network | https://string-db.org/network/866895.HBHAL_1678 | Hypothetical protein. |
| CCG44046.1 protein network | https://string-db.org/network/866895.HBHAL_1679 | Phage replication protein. |
| phrA protein network | https://string-db.org/network/866895.HBHAL_1680 | Deoxyribodipyrimidine photo-lyase; Belongs to the DNA photolyase family. |
| yuiD2 protein network | https://string-db.org/network/866895.HBHAL_1681 | Conserved hypothetical protein. |
| CCG44049.1 protein network | https://string-db.org/network/866895.HBHAL_1682 | Conserved hypothetical protein. |
| CCG44050.1 protein network | https://string-db.org/network/866895.HBHAL_1683 | Conserved hypothetical protein. |
| CCG44051.1 protein network | https://string-db.org/network/866895.HBHAL_1684 | Methyltransferase. |
| CCG44052.1 protein network | https://string-db.org/network/866895.HBHAL_1685 | MFS-type transporter (probable metal-tetracycline-proton antiporter). |
| CCG44053.1 protein network | https://string-db.org/network/866895.HBHAL_1686 | Conserved hypothetical protein. |
| CCG44054.1 protein network | https://string-db.org/network/866895.HBHAL_1687 | Conserved hypothetical protein. |
| yqhA protein network | https://string-db.org/network/866895.HBHAL_1688 | Conserved hypothetical protein. |
| CCG44056.1 protein network | https://string-db.org/network/866895.HBHAL_1689 | DUF1232 family protein. |
| CCG44057.1 protein network | https://string-db.org/network/866895.HBHAL_1690 | Conserved hypothetical protein. |
| CCG44058.1 protein network | https://string-db.org/network/866895.HBHAL_1691 | Betaine-homocysteine S-methyltransferase. |
| metC1 protein network | https://string-db.org/network/866895.HBHAL_1692 | Cystathionine beta-lyase. |
| metI protein network | https://string-db.org/network/866895.HBHAL_1693 | Cystathionine gamma-synthase. |
| CCG44061.1 protein network | https://string-db.org/network/866895.HBHAL_1694 | Hypothetical protein. |
| CCG44064.1 protein network | https://string-db.org/network/866895.HBHAL_1697 | 3-oxoacyl-[acyl-carrier protein] reductase. |
| CCG44065.1 protein network | https://string-db.org/network/866895.HBHAL_1698 | Hypothetical protein. |
| CCG44066.1 protein network | https://string-db.org/network/866895.HBHAL_1699 | Hypothetical protein. |
| CCG44067.1 protein network | https://string-db.org/network/866895.HBHAL_1701 | GntR family transcription regulator. |
| CCG44068.1 protein network | https://string-db.org/network/866895.HBHAL_1702 | ABC-type transport system ATP-binding protein. |
| CCG44069.1 protein network | https://string-db.org/network/866895.HBHAL_1703 | Conserved hypothetical protein. |
| CCG44070.1 protein network | https://string-db.org/network/866895.HBHAL_1704 | Hypothetical protein. |
| yqgS1 protein network | https://string-db.org/network/866895.HBHAL_1705 | yqgS family protein; Belongs to the LTA synthase family. |
| CCG44072.1 protein network | https://string-db.org/network/866895.HBHAL_1706 | Serine-pyruvate aminotransferase. |
| CCG44073.1 protein network | https://string-db.org/network/866895.HBHAL_1707 | Hypothetical protein; Belongs to the PlsY family. |
| CCG44074.1 protein network | https://string-db.org/network/866895.HBHAL_1708 | ABC-type transport system permease protein (probable substrate sulfonate/nitrate/taurine). |
| CCG44075.1 protein network | https://string-db.org/network/866895.HBHAL_1709 | ABC-type transport system ATP-binding protein (probable substrate sulfonate/nitrate/taurine). |
| CCG44076.1 protein network | https://string-db.org/network/866895.HBHAL_1710 | ABC-type transport system extracellular binding protein (probable substrate sulfonate/nitrate/taurine). |
| CCG44077.1 protein network | https://string-db.org/network/866895.HBHAL_1711 | Putative acetytransferase. |
| dsdA protein network | https://string-db.org/network/866895.HBHAL_1712 | D-serine ammonia-lyase; Belongs to the serine/threonine dehydratase family. DsdA subfamily. |
| CCG44079.1 protein network | https://string-db.org/network/866895.HBHAL_1713 | Short-chain dehydrogenase/reductase family protein. |
| CCG44080.1 protein network | https://string-db.org/network/866895.HBHAL_1714 | DASS family transporter (probable function sodium:sulfate symport). |
| CCG44081.1 protein network | https://string-db.org/network/866895.HBHAL_1715 | MFS-type transporter. |
| CCG44082.1 protein network | https://string-db.org/network/866895.HBHAL_1716 | Short-chain dehydrogenase/reductase family protein. |
| CCG44083.1 protein network | https://string-db.org/network/866895.HBHAL_1717 | NERD domain protein. |
| CCG44084.1 protein network | https://string-db.org/network/866895.HBHAL_1718 | PTS system subunit IIBC,N-acetylglucosamine-specific. |
| CCG44085.1 protein network | https://string-db.org/network/866895.HBHAL_1719 | Hypothetical protein. |
| CCG44086.1 protein network | https://string-db.org/network/866895.HBHAL_1720 | N-acetylglucosamine-6-phosphate deacetylase. |
| nagB protein network | https://string-db.org/network/866895.HBHAL_1721 | Glucosamine-6-phosphate deaminase; Catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate (GlcN6P) to form fructose 6-phosphate (Fru6P) and ammonium ion. |
| CCG44088.1 protein network | https://string-db.org/network/866895.HBHAL_1722 | GntR family transcription regulator. |
| CCG44089.1 protein network | https://string-db.org/network/866895.HBHAL_1723 | Hypothetical protein. |
| CCG44090.1 protein network | https://string-db.org/network/866895.HBHAL_1724 | TetR family transcription regulator. |
| CCG44091.1 protein network | https://string-db.org/network/866895.HBHAL_1725 | Hypothetical protein. |
| CCG44092.1 protein network | https://string-db.org/network/866895.HBHAL_1726 | Conserved hypothetical protein. |
| CCG44093.1 protein network | https://string-db.org/network/866895.HBHAL_1727 | Conserved hypothetical protein. |
| CCG44094.1 protein network | https://string-db.org/network/866895.HBHAL_1728 | Conserved hypothetical protein. |
| tnrA protein network | https://string-db.org/network/866895.HBHAL_1729 | Transcription regulator TnrA. |
| CCG44096.1 protein network | https://string-db.org/network/866895.HBHAL_1730 | Hypothetical protein. |
| CCG44097.1 protein network | https://string-db.org/network/866895.HBHAL_1731 | UPF0118 family protein. |
| cypC protein network | https://string-db.org/network/866895.HBHAL_1734 | Cytochrome P450. |
| rpsN1 protein network | https://string-db.org/network/866895.HBHAL_1735 | 30S ribosomal protein S14; Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site; Belongs to the un [...] |
| CCG44101.1 protein network | https://string-db.org/network/866895.HBHAL_1736 | Hypothetical protein. |
| CCG44102.1 protein network | https://string-db.org/network/866895.HBHAL_1737 | BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family. |
| CCG44103.1 protein network | https://string-db.org/network/866895.HBHAL_1738 | Hypothetical protein. |
| CCG44104.1 protein network | https://string-db.org/network/866895.HBHAL_1739 | Oxidoreductase domain protein. |
| CCG44105.1 protein network | https://string-db.org/network/866895.HBHAL_1740 | Conserved hypothetical protein. |
| CCG44106.1 protein network | https://string-db.org/network/866895.HBHAL_1741 | Conserved hypothetical protein. |
| CCG44107.1 protein network | https://string-db.org/network/866895.HBHAL_1742 | Hypothetical protein. |
| CCG44108.1 protein network | https://string-db.org/network/866895.HBHAL_1743 | Conserved hypothetical protein. |
| yoeD protein network | https://string-db.org/network/866895.HBHAL_1744 | DNA binding domain, excisionase family. |
| yabJ protein network | https://string-db.org/network/866895.HBHAL_1745 | RutC family protein YabJ. |
| CCG44111.1 protein network | https://string-db.org/network/866895.HBHAL_1746 | Hypothetical protein. |
| cstA2 protein network | https://string-db.org/network/866895.HBHAL_1747 | Carbon starvation protein CstA. |
| CCG44113.1 protein network | https://string-db.org/network/866895.HBHAL_1748 | Putative peroxiredoxin. |
| CCG44114.1 protein network | https://string-db.org/network/866895.HBHAL_1749 | Hypothetical protein. |
| CCG44115.1 protein network | https://string-db.org/network/866895.HBHAL_1750 | Deoxyribonuclease, TatD family, putative. |
| CCG44116.1 protein network | https://string-db.org/network/866895.HBHAL_1751 | ABC-type transport system ATP-binding protein (probable substrate sulfonate/nitrate/taurine). |
| CCG44117.1 protein network | https://string-db.org/network/866895.HBHAL_1752 | ABC-type transport system permease protein (probable substrate sulfonate/nitrate/taurine). |
| CCG44118.1 protein network | https://string-db.org/network/866895.HBHAL_1753 | Hypothetical protein. |
| CCG44119.1 protein network | https://string-db.org/network/866895.HBHAL_1754 | ABC-type transport system extracellular binding protein (probable substrate sulfonate/nitrate/taurine). |
| CCG44120.1 protein network | https://string-db.org/network/866895.HBHAL_1755 | Hypothetical protein. |
| CCG44121.1 protein network | https://string-db.org/network/866895.HBHAL_1756 | Hypothetical protein. |
| CCG44122.1 protein network | https://string-db.org/network/866895.HBHAL_1757 | FAD-dependent oxidoreductase. |
| CCG44123.1 protein network | https://string-db.org/network/866895.HBHAL_1758 | C45 family peptidase. |
| CCG44124.1 protein network | https://string-db.org/network/866895.HBHAL_1759 | Conserved hypothetical protein. |
| CCG44125.1 protein network | https://string-db.org/network/866895.HBHAL_1760 | Enoyl-(acyl carrier protein) reductase. |
| gdh2 protein network | https://string-db.org/network/866895.HBHAL_1761 | Glutamate dehydrogenase; Belongs to the Glu/Leu/Phe/Val dehydrogenases family. |
| CCG44127.1 protein network | https://string-db.org/network/866895.HBHAL_1762 | Hypothetical protein. |
| CCG44128.1 protein network | https://string-db.org/network/866895.HBHAL_1763 | UPF0182 family protein. |
| CCG44129.1 protein network | https://string-db.org/network/866895.HBHAL_1764 | Hypothetical protein. |
| nuc protein network | https://string-db.org/network/866895.HBHAL_1765 | Hypothetical protein. |
| CCG44131.1 protein network | https://string-db.org/network/866895.HBHAL_1766 | Hypothetical protein. |
| ppc protein network | https://string-db.org/network/866895.HBHAL_1767 | Phosphoenolpyruvate carboxylase; Forms oxaloacetate, a four-carbon dicarboxylic acid source for the tricarboxylic acid cycle; Belongs to the PEPCase type 1 family. |
| yvrE protein network | https://string-db.org/network/866895.HBHAL_1768 | Regucalcin family protein. |
| CCG44134.1 protein network | https://string-db.org/network/866895.HBHAL_1769 | Acetyltransferase, GNAT family. |
| CCG44135.1 protein network | https://string-db.org/network/866895.HBHAL_1770 | Conserved hypothetical protein. |
| CCG44136.1 protein network | https://string-db.org/network/866895.HBHAL_1771 | PadR family transcription regulator. |
| CCG44137.1 protein network | https://string-db.org/network/866895.HBHAL_1772 | Na+/H+ antiporter family protein. |
| CCG44138.1 protein network | https://string-db.org/network/866895.HBHAL_1774 | Hypothetical protein. |
| CCG44139.1 protein network | https://string-db.org/network/866895.HBHAL_1775 | Gamma-glutamyltransferase. |
| CCG44140.1 protein network | https://string-db.org/network/866895.HBHAL_1776 | Chromate transporter. |
| CCG44141.1 protein network | https://string-db.org/network/866895.HBHAL_1777 | Chromate transporter. |
| CCG44142.1 protein network | https://string-db.org/network/866895.HBHAL_1778 | Hypothetical protein. |
| msrA protein network | https://string-db.org/network/866895.HBHAL_1779 | Peptide methionine sulfoxide reductase; Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methioni [...] |
| eutH protein network | https://string-db.org/network/866895.HBHAL_1780 | Probable ethanolamine transporter. |
| CCG44145.1 protein network | https://string-db.org/network/866895.HBHAL_1781 | Redoxin. |
| ykuK protein network | https://string-db.org/network/866895.HBHAL_1782 | Conserved hypothetical protein. |
| CCG44147.1 protein network | https://string-db.org/network/866895.HBHAL_1783 | Conserved hypothetical protein. |
| CCG44148.1 protein network | https://string-db.org/network/866895.HBHAL_1784 | Hypothetical protein. |
| CCG44149.1 protein network | https://string-db.org/network/866895.HBHAL_1785 | Hypothetical protein. |
| CCG44150.1 protein network | https://string-db.org/network/866895.HBHAL_1786 | MFS-type transporter (probable function drug resistance); Belongs to the major facilitator superfamily. |
| argS1 protein network | https://string-db.org/network/866895.HBHAL_1787 | arginyl-tRNA synthetase. |
| ydfR protein network | https://string-db.org/network/866895.HBHAL_1788 | Hypothetical protein. |
| trxA5 protein network | https://string-db.org/network/866895.HBHAL_1789 | Thioredoxin. |
| CCG44154.1 protein network | https://string-db.org/network/866895.HBHAL_1790 | Hypothetical protein. |
| proH protein network | https://string-db.org/network/866895.HBHAL_1791 | Pyrroline-5-carboxylate reductase; Catalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline. |
| proJ protein network | https://string-db.org/network/866895.HBHAL_1792 | Glutamate 5-kinase; Catalyzes the transfer of a phosphate group to glutamate to form L-glutamate 5-phosphate. |
| proA protein network | https://string-db.org/network/866895.HBHAL_1793 | Gamma-glutamyl phosphate reductase; Catalyzes the NADPH-dependent reduction of L-glutamate 5- phosphate into L-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes cyclizat [...] |
| rsbR1 protein network | https://string-db.org/network/866895.HBHAL_1794 | RsbR family protein. |
| CCG44159.1 protein network | https://string-db.org/network/866895.HBHAL_1795 | Hypothetical protein. |
| CCG44160.1 protein network | https://string-db.org/network/866895.HBHAL_1796 | Spore coat protein. |
| CCG44162.1 protein network | https://string-db.org/network/866895.HBHAL_1798 | Hypothetical protein. |
| CCG44163.1 protein network | https://string-db.org/network/866895.HBHAL_1799 | acyl-CoA dehydrogenase. |
| CCG44164.1 protein network | https://string-db.org/network/866895.HBHAL_1800 | Short-chain dehydrogenase/reductase family protein. |
| CCG44165.1 protein network | https://string-db.org/network/866895.HBHAL_1801 | 3-hydroxybutyryl-CoA dehydrogenase. |
| CCG44166.1 protein network | https://string-db.org/network/866895.HBHAL_1802 | Conserved hypothetical protein. |
| CCG44167.1 protein network | https://string-db.org/network/866895.HBHAL_1803 | Conserved hypothetical protein. |
| comB protein network | https://string-db.org/network/866895.HBHAL_1804 | Putative 2-phosphosulfolactate phosphatase; Belongs to the ComB family. |
| CCG44169.1 protein network | https://string-db.org/network/866895.HBHAL_1805 | acyl-CoA dehydrogenase. |
| CCG44170.1 protein network | https://string-db.org/network/866895.HBHAL_1806 | enoyl-CoA hydratase. |
| CCG44171.1 protein network | https://string-db.org/network/866895.HBHAL_1807 | NAD(P)H:quinone oxidoreductase. |
| CCG44172.1 protein network | https://string-db.org/network/866895.HBHAL_1808 | Acetyltransferase, GNAT family. |
| CCG44173.1 protein network | https://string-db.org/network/866895.HBHAL_1809 | Hypothetical protein. |
| ydjP protein network | https://string-db.org/network/866895.HBHAL_1810 | AB hydrolase superfamily protein. |
| ilvE protein network | https://string-db.org/network/866895.HBHAL_1811 | Branched-chain amino acid aminotransferase; Acts on leucine, isoleucine and valine. Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family. |
| CCG44176.1 protein network | https://string-db.org/network/866895.HBHAL_1812 | O-methyltransferase. |
| ycsF protein network | https://string-db.org/network/866895.HBHAL_1813 | UPF0271 family protein; Catalyzes the cleavage of 5-oxoproline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate. |
| CCG44178.1 protein network | https://string-db.org/network/866895.HBHAL_1814 | Allophanate hydrolase subunit 2. |
| CCG44179.1 protein network | https://string-db.org/network/866895.HBHAL_1815 | Allophanate hydrolase subunit 1. |
| ydaT1 protein network | https://string-db.org/network/866895.HBHAL_1816 | Conserved hypothetical protein. |
| ydaT2 protein network | https://string-db.org/network/866895.HBHAL_1817 | Conserved hypothetical protein. |
| CCG44182.1 protein network | https://string-db.org/network/866895.HBHAL_1818 | Hypothetical protein. |
| CCG44184.1 protein network | https://string-db.org/network/866895.HBHAL_1820 | Putative oxidoreductase. |
| CCG44185.1 protein network | https://string-db.org/network/866895.HBHAL_1821 | Hypothetical protein. |
| CCG44186.1 protein network | https://string-db.org/network/866895.HBHAL_1822 | Hypothetical protein. |
| CCG44187.1 protein network | https://string-db.org/network/866895.HBHAL_1823 | YqiR family transcription regulator. |
| CCG44188.1 protein network | https://string-db.org/network/866895.HBHAL_1824 | Hypothetical protein. |
| iadA protein network | https://string-db.org/network/866895.HBHAL_1825 | Isoaspartyl dipeptidase; Catalyzes the hydrolytic cleavage of a subset of L- isoaspartyl (L-beta-aspartyl) dipeptides. Used to degrade proteins damaged by L-isoaspartyl residues formation. Belong [...] |
| cwlK protein network | https://string-db.org/network/866895.HBHAL_1826 | Peptidoglycan L-alanyl-D-glutamate endopeptidase CwlK. |
| CCG44192.1 protein network | https://string-db.org/network/866895.HBHAL_1828 | 2-dehydropantoate 2-reductase; Catalyzes the NADPH-dependent reduction of ketopantoate into pantoic acid. |
| CCG44193.1 protein network | https://string-db.org/network/866895.HBHAL_1829 | Hypothetical protein. |
| CCG44194.1 protein network | https://string-db.org/network/866895.HBHAL_1830 | Conserved hypothetical protein. |
| mreBH protein network | https://string-db.org/network/866895.HBHAL_1831 | Rod-shape determining protein MreBH. |
| CCG44196.1 protein network | https://string-db.org/network/866895.HBHAL_1832 | Hypothetical protein. |
| yflK protein network | https://string-db.org/network/866895.HBHAL_1833 | Hypothetical protein. |
| CCG44198.1 protein network | https://string-db.org/network/866895.HBHAL_1834 | Putative guanine/cytidine deaminase. |
| CCG44199.1 protein network | https://string-db.org/network/866895.HBHAL_1835 | Hypothetical protein. |
| CCG44200.1 protein network | https://string-db.org/network/866895.HBHAL_1836 | ABC-type transport system ATP-binding protein. |
| CCG44201.1 protein network | https://string-db.org/network/866895.HBHAL_1837 | ABC-type transport system permease protein. |
| CCG44202.1 protein network | https://string-db.org/network/866895.HBHAL_1838 | TetR family transcription regulator. |
| yoqW protein network | https://string-db.org/network/866895.HBHAL_1839 | Hypothetical protein; Belongs to the SOS response-associated peptidase family. |
| CCG44204.1 protein network | https://string-db.org/network/866895.HBHAL_1840 | Diguanylate cyclase domain protein / diguanylate phosphodiesterase domain protein. |
| CCG44206.1 protein network | https://string-db.org/network/866895.HBHAL_1842 | Conserved hypothetical protein. |
| CCG44207.1 protein network | https://string-db.org/network/866895.HBHAL_1843 | Amino acid transporter. |
| CCG44208.1 protein network | https://string-db.org/network/866895.HBHAL_1844 | Protein-tyrosine-phosphatase; Belongs to the low molecular weight phosphotyrosine protein phosphatase family. |
| CCG44209.1 protein network | https://string-db.org/network/866895.HBHAL_1845 | Hypothetical protein. |
| yihY1 protein network | https://string-db.org/network/866895.HBHAL_1846 | YihY family protein; Belongs to the UPF0761 family. |
| CCG44211.1 protein network | https://string-db.org/network/866895.HBHAL_1847 | Heavy metal-transporting P-type ATPase. |
| CCG44212.1 protein network | https://string-db.org/network/866895.HBHAL_1848 | ABC-type transport system extracellular binding protein (probable substrate amino acid); Belongs to the bacterial solute-binding protein 3 family. |
| CCG44213.1 protein network | https://string-db.org/network/866895.HBHAL_1849 | ABC-type transport system permease protein (probable substrate amino acid). |
| CCG44214.1 protein network | https://string-db.org/network/866895.HBHAL_1850 | ABC-type transport system ATP-binding protein (probable substrate zinc). |
| CCG44215.1 protein network | https://string-db.org/network/866895.HBHAL_1851 | ABC-type transport system permease protein (probable substrate zinc). |
| zur protein network | https://string-db.org/network/866895.HBHAL_1852 | Fur family transcription regulator; Belongs to the Fur family. |
| CCG44217.1 protein network | https://string-db.org/network/866895.HBHAL_1853 | ABC-type transport system extracellular binding protein (probable substrate zinc); Belongs to the bacterial solute-binding protein 9 family. |
| yfkF protein network | https://string-db.org/network/866895.HBHAL_1854 | MFS-type transporter. |
| CCG44219.1 protein network | https://string-db.org/network/866895.HBHAL_1855 | Hypothetical protein. |
| yyaS2 protein network | https://string-db.org/network/866895.HBHAL_1856 | Conserved hypothetical protein. |
| yfkD protein network | https://string-db.org/network/866895.HBHAL_1857 | Conserved hypothetical protein. |
| CCG44222.1 protein network | https://string-db.org/network/866895.HBHAL_1858 | Probable small-conductance mechanosensitive channel. |
| CCG44223.1 protein network | https://string-db.org/network/866895.HBHAL_1859 | ABC-type transport system ATP-binding protein. |
| CCG44224.1 protein network | https://string-db.org/network/866895.HBHAL_1860 | Probable ABC-type transport system permease protein. |
| CCG44225.1 protein network | https://string-db.org/network/866895.HBHAL_1861 | Two-component response regulator. |
| CCG44226.1 protein network | https://string-db.org/network/866895.HBHAL_1862 | Two-component sensor histidine kinase. |
| CCG44227.1 protein network | https://string-db.org/network/866895.HBHAL_1863 | Hypothetical protein. |
| CCG44228.1 protein network | https://string-db.org/network/866895.HBHAL_1864 | Hypothetical protein. |
| CCG44229.1 protein network | https://string-db.org/network/866895.HBHAL_1865 | Na+/H+ antiporter family protein. |
| CCG44230.1 protein network | https://string-db.org/network/866895.HBHAL_1867 | Putative polysaccharide deacetylase. |
| yfjP protein network | https://string-db.org/network/866895.HBHAL_1868 | DNA-3-methyladenine glycosylase YfjP. |
| CCG44232.1 protein network | https://string-db.org/network/866895.HBHAL_1869 | Two-component sensor histidine kinase. |
| CCG44234.1 protein network | https://string-db.org/network/866895.HBHAL_1872 | Hypothetical protein. |
| CCG44235.1 protein network | https://string-db.org/network/866895.HBHAL_1873 | acetate--CoA ligase. |
| CCG44236.1 protein network | https://string-db.org/network/866895.HBHAL_1874 | Acetyltransferase, GNAT family. |
| CCG44237.1 protein network | https://string-db.org/network/866895.HBHAL_1875 | Conserved hypothetical protein. |
| CCG44238.1 protein network | https://string-db.org/network/866895.HBHAL_1876 | Hypothetical protein. |
| CCG44241.1 protein network | https://string-db.org/network/866895.HBHAL_1879 | Hypothetical protein. |
| CCG44242.1 protein network | https://string-db.org/network/866895.HBHAL_1880 | BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family. |
| CCG44243.1 protein network | https://string-db.org/network/866895.HBHAL_1881 | Hypothetical protein. |
| CCG44244.1 protein network | https://string-db.org/network/866895.HBHAL_1882 | Conserved hypothetical protein. |
| CCG44245.1 protein network | https://string-db.org/network/866895.HBHAL_1883 | Bacterial luciferase family protein. |
| CCG44246.1 protein network | https://string-db.org/network/866895.HBHAL_1884 | Hypothetical protein. |
| CCG44247.1 protein network | https://string-db.org/network/866895.HBHAL_1885 | PTS system subunit IIBC, mannitol-specific. |
| CCG44248.1 protein network | https://string-db.org/network/866895.HBHAL_1886 | MtlR/BglG family transcription regulator. |
| CCG44249.1 protein network | https://string-db.org/network/866895.HBHAL_1887 | PTS system subunit IIA, mannitol-specific. |
| mtlD protein network | https://string-db.org/network/866895.HBHAL_1888 | Mannitol-1-phosphate 5-dehydrogenase. |
| CCG44251.1 protein network | https://string-db.org/network/866895.HBHAL_1889 | Hypothetical protein. |
| yusX protein network | https://string-db.org/network/866895.HBHAL_1890 | M3 family peptidase. |
| dcoH protein network | https://string-db.org/network/866895.HBHAL_1891 | Pterin-4-alpha-carbinolamine dehydratase,putative. |
| CCG44254.1 protein network | https://string-db.org/network/866895.HBHAL_1892 | Conserved hypothetical protein. |
| rluD1 protein network | https://string-db.org/network/866895.HBHAL_1893 | Pseudouridine synthase; Responsible for synthesis of pseudouridine from uracil. Belongs to the pseudouridine synthase RluA family. |
| CCG44256.1 protein network | https://string-db.org/network/866895.HBHAL_1894 | GTP-binding protein TypA/BipA. |
| CCG44257.1 protein network | https://string-db.org/network/866895.HBHAL_1895 | Hypothetical protein. |
| CCG44258.1 protein network | https://string-db.org/network/866895.HBHAL_1896 | Hypothetical protein. |
| yyaS5 protein network | https://string-db.org/network/866895.HBHAL_1897 | Conserved hypothetical protein. |
| CCG44260.1 protein network | https://string-db.org/network/866895.HBHAL_1898 | MFS-type transporter (probable function bicyclomycin/chloramphenicol resistance). |
| CCG44261.1 protein network | https://string-db.org/network/866895.HBHAL_1899 | IS1341-type transposase. |
| CCG44262.1 protein network | https://string-db.org/network/866895.HBHAL_1900 | Conserved hypothetical protein. |
| CCG44263.1 protein network | https://string-db.org/network/866895.HBHAL_1901 | acyl-CoA dehydrogenase. |
| CCG44264.1 protein network | https://string-db.org/network/866895.HBHAL_1902 | CAIB/BAIF family protein; Belongs to the CoA-transferase III family. |
| CCG44265.1 protein network | https://string-db.org/network/866895.HBHAL_1903 | Aminotransferase. |
| ilvB2 protein network | https://string-db.org/network/866895.HBHAL_1904 | Acetolactate synthase large subunit; Belongs to the TPP enzyme family. |
| CCG44267.1 protein network | https://string-db.org/network/866895.HBHAL_1905 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| CCG44268.1 protein network | https://string-db.org/network/866895.HBHAL_1906 | Saccharopine dehydrogenase. |
| CCG44269.1 protein network | https://string-db.org/network/866895.HBHAL_1907 | Hypothetical protein. |
| CCG44270.1 protein network | https://string-db.org/network/866895.HBHAL_1908 | 4-aminobutyrate aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. |
| ykoY1 protein network | https://string-db.org/network/866895.HBHAL_1909 | TerC family protein. |
| CCG44272.1 protein network | https://string-db.org/network/866895.HBHAL_1910 | Putative sporulation control protein. |
| CCG44273.1 protein network | https://string-db.org/network/866895.HBHAL_1911 | Hypothetical protein. |
| CCG44274.1 protein network | https://string-db.org/network/866895.HBHAL_1912 | Short-chain dehydrogenase/reductase family protein. |
| CCG44275.1 protein network | https://string-db.org/network/866895.HBHAL_1913 | Acyltransferase 3. |
| nadE1 protein network | https://string-db.org/network/866895.HBHAL_1914 | NH3-dependent NAD+ synthetase; Catalyzes the ATP-dependent amidation of deamido-NAD to form NAD. Uses ammonia as a nitrogen source; Belongs to the NAD synthetase family. |
| yaaI protein network | https://string-db.org/network/866895.HBHAL_1915 | Isochorismatase family protein. |
| mutS3 protein network | https://string-db.org/network/866895.HBHAL_1916 | DNA mismatch repair protein MutS; Endonuclease that is involved in the suppression of homologous recombination and may therefore have a key role in the control of bacterial genetic diversity. Bel [...] |
| msrA-2 protein network | https://string-db.org/network/866895.HBHAL_1917 | methionine-R-sulfoxide reductase; Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sul [...] |
| CCG44280.1 protein network | https://string-db.org/network/866895.HBHAL_1918 | Hypothetical protein. |
| CCG44281.1 protein network | https://string-db.org/network/866895.HBHAL_1919 | Conserved hypothetical protein. |
| CCG44282.1 protein network | https://string-db.org/network/866895.HBHAL_1920 | NADH:flavin oxidoreductase / NADH oxidase family protein. |
| pcrA2 protein network | https://string-db.org/network/866895.HBHAL_1921 | ATP-dependent DNA helicase PcrA. |
| CCG44284.1 protein network | https://string-db.org/network/866895.HBHAL_1922 | Probable small-conductance mechanosensitive channel. |
| CCG44285.1 protein network | https://string-db.org/network/866895.HBHAL_1924 | Hypothetical protein. |
| CCG44286.1 protein network | https://string-db.org/network/866895.HBHAL_1925 | Acetyltransferase, GNAT family. |
| CCG44287.1 protein network | https://string-db.org/network/866895.HBHAL_1926 | Conserved hypothetical protein. |
| CCG44288.1 protein network | https://string-db.org/network/866895.HBHAL_1927 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| CCG44289.1 protein network | https://string-db.org/network/866895.HBHAL_1928 | Probable ABC-type transport system permease protein. |
| CCG44290.1 protein network | https://string-db.org/network/866895.HBHAL_1929 | ABC-type transport system ATP-binding protein. |
| CCG44291.1 protein network | https://string-db.org/network/866895.HBHAL_1930 | Hypothetical protein. |
| CCG44292.1 protein network | https://string-db.org/network/866895.HBHAL_1931 | Hypothetical protein; Belongs to the UPF0145 family. |
| CCG44293.1 protein network | https://string-db.org/network/866895.HBHAL_1932 | Hypothetical protein. |
| CCG44294.1 protein network | https://string-db.org/network/866895.HBHAL_1933 | Hypothetical protein. |
| CCG44295.1 protein network | https://string-db.org/network/866895.HBHAL_1934 | Hypothetical protein. |
| sigY protein network | https://string-db.org/network/866895.HBHAL_1935 | RNA polymerase sigma factor SigY; Belongs to the sigma-70 factor family. ECF subfamily. |
| trpE protein network | https://string-db.org/network/866895.HBHAL_1936 | Anthranilate synthase component I; Part of a heterotetrameric complex that catalyzes the two- step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first [...] |
| trpD protein network | https://string-db.org/network/866895.HBHAL_1937 | Anthranilate phosphoribosyltransferase; Catalyzes the transfer of the phosphoribosyl group of 5- phosphorylribose-1-pyrophosphate (PRPP) to anthranilate to yield N-(5'- phosphoribosyl)-anthranila [...] |
| trpC protein network | https://string-db.org/network/866895.HBHAL_1938 | Indole-3-glycerol-phosphate synthase; Belongs to the TrpC family. |
| trpF protein network | https://string-db.org/network/866895.HBHAL_1939 | N-(5'-phosphoribosyl)anthranilate isomerase; Belongs to the TrpF family. |
| trpB protein network | https://string-db.org/network/866895.HBHAL_1940 | Tryptophan synthase beta subunit; The beta subunit is responsible for the synthesis of L- tryptophan from indole and L-serine. |
| trpA protein network | https://string-db.org/network/866895.HBHAL_1941 | Tryptophan synthase alpha subunit; The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate. Belongs to the TrpA family. |
| trpG1 protein network | https://string-db.org/network/866895.HBHAL_1942 | Anthranilate synthase component II. |
| CCG44304.1 protein network | https://string-db.org/network/866895.HBHAL_1943 | SSS family transporter (probable function sodium:proline symport); Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| CCG44305.1 protein network | https://string-db.org/network/866895.HBHAL_1944 | Two-component response regulator. |
| CCG44306.1 protein network | https://string-db.org/network/866895.HBHAL_1945 | Hypothetical protein. |
| sipW protein network | https://string-db.org/network/866895.HBHAL_1946 | Signal peptidase I. |
| CCG44308.1 protein network | https://string-db.org/network/866895.HBHAL_1947 | Camelysin. |
| npr1 protein network | https://string-db.org/network/866895.HBHAL_1948 | Neutral protease; Extracellular zinc metalloprotease. |
| CCG44310.1 protein network | https://string-db.org/network/866895.HBHAL_1949 | Manganese catalase. |
| xynB protein network | https://string-db.org/network/866895.HBHAL_1950 | Xylan 1,4-beta-xylosidase; Belongs to the glycosyl hydrolase 43 family. |
| CCG44312.1 protein network | https://string-db.org/network/866895.HBHAL_1951 | ROK family protein. |
| CCG44313.1 protein network | https://string-db.org/network/866895.HBHAL_1952 | ABC-type transport system extracellular binding protein (probable substrate sugar). |
| CCG44314.1 protein network | https://string-db.org/network/866895.HBHAL_1953 | ABC-type transport system permease protein (probable substrate sugar). |
| CCG44315.1 protein network | https://string-db.org/network/866895.HBHAL_1954 | ABC-type transport system permease protein (probable substrate sugar). |
| CCG44316.1 protein network | https://string-db.org/network/866895.HBHAL_1955 | Conserved hypothetical protein. |
| xylA protein network | https://string-db.org/network/866895.HBHAL_1956 | Xylose isomerase; Belongs to the xylose isomerase family. |
| xylB protein network | https://string-db.org/network/866895.HBHAL_1957 | Xylulose kinase. |
| CCG44319.1 protein network | https://string-db.org/network/866895.HBHAL_1958 | Oxidoreductase, aldo/keto reductase family. |
| mro protein network | https://string-db.org/network/866895.HBHAL_1959 | Aldose 1-epimerase; Converts alpha-aldose to the beta-anomer. |
| CCG44321.1 protein network | https://string-db.org/network/866895.HBHAL_1960 | Hypothetical protein. |
| CCG44322.1 protein network | https://string-db.org/network/866895.HBHAL_1961 | Hypothetical protein. |
| CCG44323.1 protein network | https://string-db.org/network/866895.HBHAL_1962 | Capsular polysaccharide biosynthesis protein. |
| CCG44324.1 protein network | https://string-db.org/network/866895.HBHAL_1963 | Capsular polysaccharide biosynthesis protein,putative tyrosine-protein kinase. |
| CCG44325.1 protein network | https://string-db.org/network/866895.HBHAL_1964 | Capsular polysaccharide biosynthesis protein. |
| epsD protein network | https://string-db.org/network/866895.HBHAL_1965 | Probable glycosyltransferase EpsD. |
| CCG44327.1 protein network | https://string-db.org/network/866895.HBHAL_1966 | Group 1 glycosyltransferase. |
| CCG44328.1 protein network | https://string-db.org/network/866895.HBHAL_1967 | Group 2 glycosyltransferase. |
| yveQ protein network | https://string-db.org/network/866895.HBHAL_1968 | Hypothetical protein. |
| galE1 protein network | https://string-db.org/network/866895.HBHAL_1969 | UDP-glucose 4-epimerase; Belongs to the NAD(P)-dependent epimerase/dehydratase family. |
| CCG44331.1 protein network | https://string-db.org/network/866895.HBHAL_1970 | Undecaprenyl-phosphate galactose phosphotransferase. |
| epsM protein network | https://string-db.org/network/866895.HBHAL_1971 | Probable acetyltransferase EpsM. |
| CCG44333.1 protein network | https://string-db.org/network/866895.HBHAL_1972 | Putative aminotransferase; Belongs to the DegT/DnrJ/EryC1 family. |
| sinR protein network | https://string-db.org/network/866895.HBHAL_1973 | Transcription regulator SinR. |
| CCG44335.1 protein network | https://string-db.org/network/866895.HBHAL_1974 | Group 1 glycosyltransferase. |
| CCG44336.1 protein network | https://string-db.org/network/866895.HBHAL_1975 | Capsular polysaccharide biosynthesis protein. |
| wcmJ protein network | https://string-db.org/network/866895.HBHAL_1976 | Hypothetical protein. |
| CCG44338.1 protein network | https://string-db.org/network/866895.HBHAL_1977 | Hypothetical protein. |
| CCG44339.1 protein network | https://string-db.org/network/866895.HBHAL_1978 | Polysaccharide biosynthesis protein. |
| prk protein network | https://string-db.org/network/866895.HBHAL_1979 | Phosphoribulokinase. |
| CCG44341.1 protein network | https://string-db.org/network/866895.HBHAL_1980 | HAD superfamily hydrolase. |
| CCG44342.1 protein network | https://string-db.org/network/866895.HBHAL_1981 | Class II aldolase/adducin family protein. |
| CCG44343.1 protein network | https://string-db.org/network/866895.HBHAL_1982 | Conserved hypothetical protein. |
| CCG44344.1 protein network | https://string-db.org/network/866895.HBHAL_1983 | Group 2 glycosyltransferase. |
| CCG44345.1 protein network | https://string-db.org/network/866895.HBHAL_1984 | Conserved hypothetical protein. |
| CCG44346.1 protein network | https://string-db.org/network/866895.HBHAL_1985 | Hypothetical protein. |
| yclG protein network | https://string-db.org/network/866895.HBHAL_1986 | Hypothetical protein. |
| HBHAL_1988 protein network | https://string-db.org/network/866895.HBHAL_1988 | ABC-type transport system ATP-binding protein (nonfunctional). |
| CCG44350.1 protein network | https://string-db.org/network/866895.HBHAL_1989 | Hypothetical protein. |
| CCG44351.1 protein network | https://string-db.org/network/866895.HBHAL_1990 | Hypothetical protein. |
| CCG44352.1 protein network | https://string-db.org/network/866895.HBHAL_1991 | ABC-type transport system ATP-binding/permease protein. |
| CCG44353.1 protein network | https://string-db.org/network/866895.HBHAL_1992 | Hypothetical protein. |
| CCG44354.1 protein network | https://string-db.org/network/866895.HBHAL_1993 | Conserved hypothetical protein. |
| CCG44355.1 protein network | https://string-db.org/network/866895.HBHAL_1994 | Conserved hypothetical protein. |
| CCG44356.1 protein network | https://string-db.org/network/866895.HBHAL_1995 | Probable RNA-directed DNA polymerase. |
| CCG44357.1 protein network | https://string-db.org/network/866895.HBHAL_1996 | Short-chain dehydrogenase/reductase family protein. |
| CCG44358.1 protein network | https://string-db.org/network/866895.HBHAL_1997 | Hypothetical protein. |
| CCG44359.1 protein network | https://string-db.org/network/866895.HBHAL_1998 | Hypothetical protein. |
| CCG44360.1 protein network | https://string-db.org/network/866895.HBHAL_1999 | Hypothetical protein. |
| alkK protein network | https://string-db.org/network/866895.HBHAL_2000 | AMP-binding enzyme. |
| CCG44362.1 protein network | https://string-db.org/network/866895.HBHAL_2001 | Hypothetical protein. |
| CCG44363.1 protein network | https://string-db.org/network/866895.HBHAL_2002 | Putative beta-ketoadipate enol-lactone hydrolase. |
| CCG44364.1 protein network | https://string-db.org/network/866895.HBHAL_2003 | Hypothetical protein. |
| CCG44365.1 protein network | https://string-db.org/network/866895.HBHAL_2004 | Putative bile acid/sodium symporter (BASS) family protein. |
| CCG44366.1 protein network | https://string-db.org/network/866895.HBHAL_2005 | Hypothetical protein. |
| CCG44367.1 protein network | https://string-db.org/network/866895.HBHAL_2006 | Hypothetical protein. |
| CCG44368.1 protein network | https://string-db.org/network/866895.HBHAL_2007 | Hypothetical protein. |
| queE protein network | https://string-db.org/network/866895.HBHAL_2008 | 7-carboxy-7-deazaguanine synthase; Catalyzes the complex heterocyclic radical-mediated conversion of 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) to 7-carboxy-7- deazaguanine (CDG), a step common to [...] |
| ygcM protein network | https://string-db.org/network/866895.HBHAL_2009 | 6-pyruvoyl tetrahydrobiopterin synthase. |
| queC protein network | https://string-db.org/network/866895.HBHAL_2010 | 7-cyano-7-deazaguanine synthase; Catalyzes the ATP-dependent conversion of 7-carboxy-7- deazaguanine (CDG) to 7-cyano-7-deazaguanine (preQ(0)). |
| CCG44372.1 protein network | https://string-db.org/network/866895.HBHAL_2011 | L-lactate permease family transporter; Transports L-lactate across the membrane. Can also transport D-lactate and glycolate; Belongs to the lactate permease family. |
| argG protein network | https://string-db.org/network/866895.HBHAL_2012 | Argininosuccinate synthase; Belongs to the argininosuccinate synthase family. Type 1 subfamily. |
| argH protein network | https://string-db.org/network/866895.HBHAL_2013 | Argininosuccinate lyase. |
| CCG44375.1 protein network | https://string-db.org/network/866895.HBHAL_2014 | Hypothetical protein. |
| CCG44376.1 protein network | https://string-db.org/network/866895.HBHAL_2015 | Hypothetical protein. |
| CCG44377.1 protein network | https://string-db.org/network/866895.HBHAL_2016 | Hypothetical protein. |
| yqgT protein network | https://string-db.org/network/866895.HBHAL_2017 | gamma-D-glutamyl-L-diamino acid endopeptidase. |
| CCG44379.1 protein network | https://string-db.org/network/866895.HBHAL_2018 | Peroxiredoxin; Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against [...] |
| deaD protein network | https://string-db.org/network/866895.HBHAL_2019 | ATP-dependent RNA helicase. |
| yrrT protein network | https://string-db.org/network/866895.HBHAL_2020 | S-adenosylmethionine-dependent methyltransferase YrrT; Could be a S-adenosyl-L-methionine-dependent methyltransferase. |
| luxS protein network | https://string-db.org/network/866895.HBHAL_2021 | S-ribosylhomocysteine lyase; Involved in the synthesis of autoinducer 2 (AI-2) which is secreted by bacteria and is used to communicate both the cell density and the metabolic potential of the en [...] |
| mccA protein network | https://string-db.org/network/866895.HBHAL_2022 | O-acetylserine dependent cystathionine beta-synthase. |
| mccB protein network | https://string-db.org/network/866895.HBHAL_2023 | Cystathionine gamma-lyase / homocysteine gamma-lyase. |
| yteA protein network | https://string-db.org/network/866895.HBHAL_2024 | YteA family regulatory protein. |
| CCG44386.1 protein network | https://string-db.org/network/866895.HBHAL_2025 | Conserved hypothetical protein. |
| CCG44387.1 protein network | https://string-db.org/network/866895.HBHAL_2026 | ABC-type transport system ATP-binding protein (probable substrate sulfonate/nitrate/taurine). |
| CCG44388.1 protein network | https://string-db.org/network/866895.HBHAL_2027 | ABC-type transport system permease protein (probable substrate sulfonate/nitrate/taurine). |
| CCG44389.1 protein network | https://string-db.org/network/866895.HBHAL_2028 | ABC-type transport system extracellular binding protein (probable substrate sulfonate/nitrate/taurine). |
| CCG44390.1 protein network | https://string-db.org/network/866895.HBHAL_2029 | YqiR family transcription regulator. |
| CCG44391.1 protein network | https://string-db.org/network/866895.HBHAL_2030 | 3-oxoacid CoA-transferase. |
| CCG44392.1 protein network | https://string-db.org/network/866895.HBHAL_2031 | 3-oxoacid CoA-transferase. |
| CCG44393.1 protein network | https://string-db.org/network/866895.HBHAL_2032 | Short-chain dehydrogenase/reductase family protein. |
| CCG44394.1 protein network | https://string-db.org/network/866895.HBHAL_2033 | acetyl-CoA acyltransferase; Belongs to the thiolase-like superfamily. Thiolase family. |
| CCG44395.1 protein network | https://string-db.org/network/866895.HBHAL_2034 | CCS family transporter (probable substrate citrate). |
| CCG44396.1 protein network | https://string-db.org/network/866895.HBHAL_2035 | Acetyltransferase, GNAT family. |
| CCG44397.1 protein network | https://string-db.org/network/866895.HBHAL_2036 | Hypothetical protein. |
| CCG44398.1 protein network | https://string-db.org/network/866895.HBHAL_2037 | Conserved hypothetical protein. |
| CCG44399.1 protein network | https://string-db.org/network/866895.HBHAL_2038 | Peptidase C60 sortase A and B. |
| CCG44400.1 protein network | https://string-db.org/network/866895.HBHAL_2039 | Hypothetical protein. |
| hutI protein network | https://string-db.org/network/866895.HBHAL_2040 | Putative imidazolonepropionase. |
| yfhF protein network | https://string-db.org/network/866895.HBHAL_2041 | Epimerase family protein YfhF. |
| recX protein network | https://string-db.org/network/866895.HBHAL_2042 | Recombination regulator RecX; Modulates RecA activity; Belongs to the RecX family. |
| CCG44404.1 protein network | https://string-db.org/network/866895.HBHAL_2043 | IS1341-type transposase. |
| CCG44405.1 protein network | https://string-db.org/network/866895.HBHAL_2044 | NUDIX family hydrolase; Belongs to the Nudix hydrolase family. |
| CCG44406.1 protein network | https://string-db.org/network/866895.HBHAL_2045 | HAD superfamily hydrolase. |
| CCG44407.1 protein network | https://string-db.org/network/866895.HBHAL_2046 | GlcT family transcription regulator. |
| CCG44408.1 protein network | https://string-db.org/network/866895.HBHAL_2047 | PTS system subunit IIBC, glucose-specific. |
| CCG44409.1 protein network | https://string-db.org/network/866895.HBHAL_2048 | Phosphocarrier protein HPr. |
| CCG44410.1 protein network | https://string-db.org/network/866895.HBHAL_2049 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| yfhH protein network | https://string-db.org/network/866895.HBHAL_2050 | Hypothetical protein. |
| yfhJ protein network | https://string-db.org/network/866895.HBHAL_2051 | Hypothetical protein. |
| yfhP protein network | https://string-db.org/network/866895.HBHAL_2052 | Conserved hypothetical protein. |
| yfhQ protein network | https://string-db.org/network/866895.HBHAL_2053 | A/G-specific adenine glycosylase; Adenine glycosylase active on G-A mispairs. |
| CCG44415.1 protein network | https://string-db.org/network/866895.HBHAL_2054 | Hypothetical protein. |
| lytE1 protein network | https://string-db.org/network/866895.HBHAL_2055 | Cell wall hydrolase LytE. |
| sspE protein network | https://string-db.org/network/866895.HBHAL_2056 | Gamma-type small, acid-soluble spore protein. |
| CCG44418.1 protein network | https://string-db.org/network/866895.HBHAL_2057 | Hypothetical protein. |
| CCG44419.1 protein network | https://string-db.org/network/866895.HBHAL_2058 | Conserved hypothetical protein; Belongs to the UPF0374 family. |
| CCG44420.1 protein network | https://string-db.org/network/866895.HBHAL_2059 | ABC-type transport system ATP-binding/permease protein. |
| CCG44421.1 protein network | https://string-db.org/network/866895.HBHAL_2060 | Hypothetical protein. |
| CCG44422.1 protein network | https://string-db.org/network/866895.HBHAL_2061 | Conserved hypothetical protein. |
| CCG44423.1 protein network | https://string-db.org/network/866895.HBHAL_2062 | Hypothetical protein. |
| hemL-2 protein network | https://string-db.org/network/866895.HBHAL_2063 | Glutamate-1-semialdehyde aminotransferase. |
| CCG44425.1 protein network | https://string-db.org/network/866895.HBHAL_2064 | Conserved hypothetical protein. |
| ygaF protein network | https://string-db.org/network/866895.HBHAL_2065 | Probable peroxiredoxin YgaF. |
| CCG44427.1 protein network | https://string-db.org/network/866895.HBHAL_2066 | Probable 2-hydroxyacid dehydrogenase (NAD); Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. |
| pduO protein network | https://string-db.org/network/866895.HBHAL_2067 | cob(I)yrinic acid a,c-diamide adenosyltransferase; Belongs to the Cob(I)alamin adenosyltransferase family. |
| perR protein network | https://string-db.org/network/866895.HBHAL_2068 | Fur family transcription regulator; Belongs to the Fur family. |
| CCG44430.1 protein network | https://string-db.org/network/866895.HBHAL_2069 | Hypothetical protein. |
| ygxA protein network | https://string-db.org/network/866895.HBHAL_2070 | Hypothetical protein. |
| CCG44432.1 protein network | https://string-db.org/network/866895.HBHAL_2074 | Hypothetical protein. |
| CCG44433.1 protein network | https://string-db.org/network/866895.HBHAL_2075 | Hypothetical protein. |
| ade2 protein network | https://string-db.org/network/866895.HBHAL_2076 | Adenine deaminase; Belongs to the metallo-dependent hydrolases superfamily. Adenine deaminase family. |
| traB protein network | https://string-db.org/network/866895.HBHAL_2077 | TraB family protein. |
| CCG44436.1 protein network | https://string-db.org/network/866895.HBHAL_2078 | Hypothetical protein. |
| CCG44437.1 protein network | https://string-db.org/network/866895.HBHAL_2079 | DUF6 family protein. |
| CCG44438.1 protein network | https://string-db.org/network/866895.HBHAL_2080 | Hypothetical protein. |
| CCG44440.1 protein network | https://string-db.org/network/866895.HBHAL_2082 | Hypothetical protein. |
| queG protein network | https://string-db.org/network/866895.HBHAL_2083 | Hypothetical protein; Catalyzes the conversion of epoxyqueuosine (oQ) to queuosine (Q), which is a hypermodified base found in the wobble positions of tRNA(Asp), tRNA(Asn), tRNA(His) and tRNA(Tyr [...] |
| CCG44442.1 protein network | https://string-db.org/network/866895.HBHAL_2084 | methylated-DNA--protein- cysteinemethyltransferase; Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the [...] |
| yhbB protein network | https://string-db.org/network/866895.HBHAL_2085 | Hypothetical protein. |
| CCG44444.1 protein network | https://string-db.org/network/866895.HBHAL_2086 | RNA methyltransferase; Could methylate the ribose at the nucleotide 34 wobble position in tRNA; Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH [...] |
| CCG44445.1 protein network | https://string-db.org/network/866895.HBHAL_2087 | IS150-type transposase orfAB. |
| lipA protein network | https://string-db.org/network/866895.HBHAL_2091 | Lipoyl synthase; Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, there [...] |
| lipM protein network | https://string-db.org/network/866895.HBHAL_2092 | Octanoyltransferase LipM. |
| prkA protein network | https://string-db.org/network/866895.HBHAL_2093 | Serine/threonine-protein kinase PrkA. |
| ppx protein network | https://string-db.org/network/866895.HBHAL_2094 | Ppx/GppA phosphatase family protein. |
| ppk protein network | https://string-db.org/network/866895.HBHAL_2095 | Polyphosphate kinase; Catalyzes the reversible transfer of the terminal phosphate of ATP to form a long-chain polyphosphate (polyP). Belongs to the polyphosphate kinase 1 (PPK1) family. |
| kgd protein network | https://string-db.org/network/866895.HBHAL_2096 | 2-oxoglutarate dehydrogenase; E1 component of the 2-oxoglutarate dehydrogenase (OGDH) complex which catalyzes the decarboxylation of 2-oxoglutarate, the first step in the conversion of 2-oxogluta [...] |
| odhB protein network | https://string-db.org/network/866895.HBHAL_2097 | 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase); E2 component of the 2-oxoglutarate dehydrogenase (OGDH) complex which catalyzes the second step in the conversion [...] |
| CCG44454.1 protein network | https://string-db.org/network/866895.HBHAL_2098 | Hypothetical protein. |
| yidC protein network | https://string-db.org/network/866895.HBHAL_2099 | Membrane protein insertase YidC; Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane pro [...] |
| CCG44456.1 protein network | https://string-db.org/network/866895.HBHAL_2100 | UPF0229 family protein; Belongs to the UPF0229 family. |
| helD protein network | https://string-db.org/network/866895.HBHAL_2101 | Helicase IV. |
| CCG44458.1 protein network | https://string-db.org/network/866895.HBHAL_2102 | Na+/H+ antiporter family protein. |
| proC protein network | https://string-db.org/network/866895.HBHAL_2103 | Pyrroline-5-carboxylate reductase; Catalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline. |
| ydbS protein network | https://string-db.org/network/866895.HBHAL_2104 | UPF0699 family protein YdbS. |
| ydbT protein network | https://string-db.org/network/866895.HBHAL_2105 | UPF0699 family protein YdbT. |
| CCG44462.1 protein network | https://string-db.org/network/866895.HBHAL_2106 | MFS-type transporter (probable substrate xanthine/uracil). |
| CCG44463.1 protein network | https://string-db.org/network/866895.HBHAL_2107 | Spore germination protein. |
| CCG44464.1 protein network | https://string-db.org/network/866895.HBHAL_2108 | Spore germination protein. |
| CCG44465.1 protein network | https://string-db.org/network/866895.HBHAL_2109 | Spore germination protein. |
| CCG44466.1 protein network | https://string-db.org/network/866895.HBHAL_2110 | Conserved hypothetical protein. |
| CCG44467.1 protein network | https://string-db.org/network/866895.HBHAL_2111 | CNT family transporter. |
| CCG44468.1 protein network | https://string-db.org/network/866895.HBHAL_2112 | Aldehyde dehydrogenase. |
| norM protein network | https://string-db.org/network/866895.HBHAL_2114 | MATE efflux family protein. |
| murG protein network | https://string-db.org/network/866895.HBHAL_2116 | Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase; Cell wall formation. Catalyzes the transfer of a GlcNAc subunit on undecaprenyl-pyrophosphoryl-MurNAc-pentapeptide (lipid interme [...] |
| CCG44472.1 protein network | https://string-db.org/network/866895.HBHAL_2117 | Putative anti-sigma regulatory factor,serine/threonine protein kinase. |
| CCG44473.1 protein network | https://string-db.org/network/866895.HBHAL_2118 | Hypothetical protein. |
| CCG44474.1 protein network | https://string-db.org/network/866895.HBHAL_2119 | UvrD/REP helicase family protein. |
| CCG44475.1 protein network | https://string-db.org/network/866895.HBHAL_2120 | 2,5-didehydrogluconate reductase. |
| CCG44476.1 protein network | https://string-db.org/network/866895.HBHAL_2121 | Spore germination protein. |
| CCG44477.1 protein network | https://string-db.org/network/866895.HBHAL_2122 | Spore germination protein. |
| CCG44478.1 protein network | https://string-db.org/network/866895.HBHAL_2123 | Spore germination protein. |
| CCG44479.1 protein network | https://string-db.org/network/866895.HBHAL_2124 | Conserved hypothetical protein. |
| CCG44480.1 protein network | https://string-db.org/network/866895.HBHAL_2125 | ABC-type transport system ATP-binding/permease protein. |
| CCG44481.1 protein network | https://string-db.org/network/866895.HBHAL_2126 | ABC-type transport system ATP-binding/permease protein. |
| mucD protein network | https://string-db.org/network/866895.HBHAL_2127 | S7 family peptidase. |
| CCG44483.1 protein network | https://string-db.org/network/866895.HBHAL_2128 | Hypothetical protein. |
| sigI protein network | https://string-db.org/network/866895.HBHAL_2129 | RNA polymerase sigma factor SigI; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released; Belongs to the sigma-70 fa [...] |
| ykrI protein network | https://string-db.org/network/866895.HBHAL_2130 | Hypothetical protein. |
| CCG44486.1 protein network | https://string-db.org/network/866895.HBHAL_2131 | Conserved hypothetical protein. |
| CCG44487.1 protein network | https://string-db.org/network/866895.HBHAL_2132 | FAD-dependent oxidoreductase. |
| yhcX protein network | https://string-db.org/network/866895.HBHAL_2134 | Probable carbon-nitrogen hydrolase. |
| CCG44490.1 protein network | https://string-db.org/network/866895.HBHAL_2135 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| yhdB protein network | https://string-db.org/network/866895.HBHAL_2136 | Hypothetical protein. |
| CCG44492.1 protein network | https://string-db.org/network/866895.HBHAL_2137 | Hypothetical protein. |
| CCG44493.1 protein network | https://string-db.org/network/866895.HBHAL_2138 | Conserved hypothetical protein. |
| CCG44494.1 protein network | https://string-db.org/network/866895.HBHAL_2139 | Acetyltransferase, GNAT family. |
| CCG44495.1 protein network | https://string-db.org/network/866895.HBHAL_2140 | Hypothetical protein. |
| CCG44496.1 protein network | https://string-db.org/network/866895.HBHAL_2141 | Stage V sporulation protein R. |
| CCG44497.1 protein network | https://string-db.org/network/866895.HBHAL_2142 | Hypothetical protein. |
| pyrH2 protein network | https://string-db.org/network/866895.HBHAL_2143 | Uridylate kinase; Catalyzes the reversible phosphorylation of UMP to UDP. |
| CCG44499.1 protein network | https://string-db.org/network/866895.HBHAL_2144 | D-amino-acid aminotransferase. |
| CCG44500.1 protein network | https://string-db.org/network/866895.HBHAL_2145 | Conserved hypothetical protein. |
| yyaS3 protein network | https://string-db.org/network/866895.HBHAL_2146 | Conserved hypothetical protein. |
| CCG44502.1 protein network | https://string-db.org/network/866895.HBHAL_2147 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| CCG44503.1 protein network | https://string-db.org/network/866895.HBHAL_2148 | Hypothetical protein. |
| CCG44504.1 protein network | https://string-db.org/network/866895.HBHAL_2149 | Conserved hypothetical protein. |
| CCG44507.1 protein network | https://string-db.org/network/866895.HBHAL_2153 | Na+/H+ antiporter family protein. |
| CCG44508.1 protein network | https://string-db.org/network/866895.HBHAL_2154 | Hypothetical protein. |
| CCG44510.1 protein network | https://string-db.org/network/866895.HBHAL_2156 | Hypothetical protein. |
| CCG44511.1 protein network | https://string-db.org/network/866895.HBHAL_2157 | Acetyltransferase, GNAT family. |
| CCG44512.1 protein network | https://string-db.org/network/866895.HBHAL_2158 | Sulfate transporter familiy protein. |
| uspA1 protein network | https://string-db.org/network/866895.HBHAL_2159 | UspA domain protein. |
| CCG44514.1 protein network | https://string-db.org/network/866895.HBHAL_2160 | Conserved hypothetical protein. |
| CCG44515.1 protein network | https://string-db.org/network/866895.HBHAL_2161 | Probable ABC-type transport system permease protein. |
| CCG44516.1 protein network | https://string-db.org/network/866895.HBHAL_2162 | ABC-type transport system ATP-binding protein. |
| CCG44517.1 protein network | https://string-db.org/network/866895.HBHAL_2163 | Acetyltransferase, GNAT family. |
| CCG44518.1 protein network | https://string-db.org/network/866895.HBHAL_2164 | Maltose O-acetyltransferase. |
| map2 protein network | https://string-db.org/network/866895.HBHAL_2165 | Methionine aminopeptidase; Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharg [...] |
| cspB protein network | https://string-db.org/network/866895.HBHAL_2166 | Major cold-shock protein. |
| CCG44521.1 protein network | https://string-db.org/network/866895.HBHAL_2167 | Conserved hypothetical protein. |
| ycgS protein network | https://string-db.org/network/866895.HBHAL_2168 | Aromatic hydrocarbon catabolism protein. |
| CCG44523.1 protein network | https://string-db.org/network/866895.HBHAL_2169 | ABC-type transport system extracellular binding protein (probable substrate iron complex). |
| CCG44524.1 protein network | https://string-db.org/network/866895.HBHAL_2170 | Metallo-beta-lactamase family protein. |
| CCG44525.1 protein network | https://string-db.org/network/866895.HBHAL_2171 | Na+/H+ antiporter family protein. |
| azlC protein network | https://string-db.org/network/866895.HBHAL_2172 | AzlC family protein. |
| CCG44527.1 protein network | https://string-db.org/network/866895.HBHAL_2173 | Hypothetical protein. |
| CCG44528.1 protein network | https://string-db.org/network/866895.HBHAL_2174 | Conserved hypothetical protein. |
| CCG44529.1 protein network | https://string-db.org/network/866895.HBHAL_2175 | Acetyltransferase, GNAT family. |
| CCG44530.1 protein network | https://string-db.org/network/866895.HBHAL_2176 | Cation efflux family protein; Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. |
| wrbA protein network | https://string-db.org/network/866895.HBHAL_2177 | NADH--quinone oxidoreductase WrbA; Belongs to the WrbA family. |
| CCG44532.1 protein network | https://string-db.org/network/866895.HBHAL_2178 | Hypothetical protein. |
| yodJ protein network | https://string-db.org/network/866895.HBHAL_2179 | D-alanyl-D-alanine carboxypeptidase. |
| CCG44534.1 protein network | https://string-db.org/network/866895.HBHAL_2180 | Conserved hypothetical protein. |
| CCG44535.1 protein network | https://string-db.org/network/866895.HBHAL_2181 | MFS-type transporter. |
| CCG44536.1 protein network | https://string-db.org/network/866895.HBHAL_2182 | Conserved hypothetical protein. |
| fumC protein network | https://string-db.org/network/866895.HBHAL_2183 | Fumarate hydratase; Involved in the TCA cycle. Catalyzes the stereospecific interconversion of fumarate to L-malate; Belongs to the class-II fumarase/aspartase family. Fumarase subfamily. |
| Sh-1 protein network | https://string-db.org/network/866895.HBHAL_2184 | Small acid-soluble spore protein 1; SASP are bound to spore DNA. They are double-stranded DNA- binding proteins that cause DNA to change to an a-like conformation. They protect the DNA backbone f [...] |
| CCG44539.1 protein network | https://string-db.org/network/866895.HBHAL_2185 | Hypothetical protein. |
| CCG44540.1 protein network | https://string-db.org/network/866895.HBHAL_2186 | ABC-type transport system ATP-binding protein; Belongs to the ABC transporter superfamily. |
| yxkF protein network | https://string-db.org/network/866895.HBHAL_2187 | Hypothetical protein. |
| CCG44542.1 protein network | https://string-db.org/network/866895.HBHAL_2188 | Conserved hypothetical protein. |
| CCG44544.1 protein network | https://string-db.org/network/866895.HBHAL_2190 | UPF0754 family protein; Belongs to the UPF0754 family. |
| yheA protein network | https://string-db.org/network/866895.HBHAL_2191 | Hypothetical protein; Belongs to the UPF0342 family. |
| CCG44546.1 protein network | https://string-db.org/network/866895.HBHAL_2192 | enoyl-CoA hydratase / 3-hydroxybutyryl-CoA dehydratase. |
| CCG44547.1 protein network | https://string-db.org/network/866895.HBHAL_2193 | Hypothetical protein. |
| CCG44548.1 protein network | https://string-db.org/network/866895.HBHAL_2194 | ABC-type transport system ATP-binding protein (probable substrate sodium). |
| CCG44549.1 protein network | https://string-db.org/network/866895.HBHAL_2195 | ABC-type transport system permease protein (probable substrate sodium). |
| CCG44550.1 protein network | https://string-db.org/network/866895.HBHAL_2196 | DNA repair exonuclease family protein. |
| yhaN protein network | https://string-db.org/network/866895.HBHAL_2197 | Hypothetical protein. |
| CCG44552.1 protein network | https://string-db.org/network/866895.HBHAL_2198 | YuaC family transcription regulator; Belongs to the GbsR family. |
| yhaM protein network | https://string-db.org/network/866895.HBHAL_2199 | 3'-5' exoribonuclease YhaM. |
| CCG44554.1 protein network | https://string-db.org/network/866895.HBHAL_2200 | Hypothetical protein. |
| CCG44555.1 protein network | https://string-db.org/network/866895.HBHAL_2202 | IS150-type transposase orfAB. |
| prsA protein network | https://string-db.org/network/866895.HBHAL_2203 | Peptidylprolyl isomerase; Plays a major role in protein secretion by helping the post- translocational extracellular folding of several secreted proteins. |
| yhaK protein network | https://string-db.org/network/866895.HBHAL_2204 | Hypothetical protein. |
| hpr protein network | https://string-db.org/network/866895.HBHAL_2205 | MarR family transcription regulator Hpr. |
| CCG44559.1 protein network | https://string-db.org/network/866895.HBHAL_2206 | YuaC family transcription regulator; Belongs to the GbsR family. |
| CCG44560.1 protein network | https://string-db.org/network/866895.HBHAL_2207 | ABC-type transport system ATP-binding protein (probable substrate glycine betaine). |
| CCG44561.1 protein network | https://string-db.org/network/866895.HBHAL_2208 | ABC-type transport system permease protein (probable substrate glycine betaine). |
| CCG44562.1 protein network | https://string-db.org/network/866895.HBHAL_2209 | ABC-type transport system extracellular binding protein (probable substrate glycine betaine). |
| yhaH protein network | https://string-db.org/network/866895.HBHAL_2210 | Hypothetical protein. |
| trpP protein network | https://string-db.org/network/866895.HBHAL_2211 | Probable tryptophan transport protein. |
| CCG44565.1 protein network | https://string-db.org/network/866895.HBHAL_2212 | Hit-like protein involved in cell-cycle regulation. |
| CCG44567.1 protein network | https://string-db.org/network/866895.HBHAL_2214 | ABC-type transport system ATP-binding protein. |
| CCG44568.1 protein network | https://string-db.org/network/866895.HBHAL_2215 | ABC-type transport system permease protein. |
| CCG44569.1 protein network | https://string-db.org/network/866895.HBHAL_2216 | Hypothetical protein. |
| ecsC protein network | https://string-db.org/network/866895.HBHAL_2217 | EcsC protein. |
| CCG44572.1 protein network | https://string-db.org/network/866895.HBHAL_2219 | Bacterioferritin. |
| CCG44573.1 protein network | https://string-db.org/network/866895.HBHAL_2220 | Conserved hypothetical protein. |
| CCG44574.1 protein network | https://string-db.org/network/866895.HBHAL_2221 | Two-component sensor histidine kinase. |
| CCG44575.1 protein network | https://string-db.org/network/866895.HBHAL_2222 | Two-component response regulator. |
| CCG44576.1 protein network | https://string-db.org/network/866895.HBHAL_2223 | Hypothetical protein. |
| CCG44577.1 protein network | https://string-db.org/network/866895.HBHAL_2224 | Hypothetical protein. |
| bdbC protein network | https://string-db.org/network/866895.HBHAL_2225 | Putative disulfide bond formation protein; Required for disulfide bond formation in some proteins. Belongs to the DsbB family. BdbC subfamily. |
| trxA4 protein network | https://string-db.org/network/866895.HBHAL_2226 | Thioredoxin. |
| yhgC protein network | https://string-db.org/network/866895.HBHAL_2227 | Conserved hypothetical protein. |
| pbpF protein network | https://string-db.org/network/866895.HBHAL_2228 | Penicillin binding protein 1F. |
| hemE protein network | https://string-db.org/network/866895.HBHAL_2229 | Uroporphyrinogen decarboxylase; Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III. |
| hemH protein network | https://string-db.org/network/866895.HBHAL_2230 | Ferrochelatase; Catalyzes the ferrous insertion into protoporphyrin IX. Belongs to the ferrochelatase family. |
| CCG44584.1 protein network | https://string-db.org/network/866895.HBHAL_2231 | Protoporphyrinogen oxidase; Catalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX. |
| CCG44585.1 protein network | https://string-db.org/network/866895.HBHAL_2232 | LacI family transcription regulator. |
| CCG44587.1 protein network | https://string-db.org/network/866895.HBHAL_2234 | Hypothetical protein. |
| yhfI protein network | https://string-db.org/network/866895.HBHAL_2235 | Beta-lactamase domain protein. |
| lplJ protein network | https://string-db.org/network/866895.HBHAL_2236 | Lipoate-protein ligase LplJ. |
| CCG44590.1 protein network | https://string-db.org/network/866895.HBHAL_2237 | long-chain-fatty-acid--CoA ligase. |
| CCG44591.1 protein network | https://string-db.org/network/866895.HBHAL_2238 | Hypothetical protein. |
| CCG44592.1 protein network | https://string-db.org/network/866895.HBHAL_2239 | Hypothetical protein. |
| CCG44593.1 protein network | https://string-db.org/network/866895.HBHAL_2240 | Hypothetical protein. |
| comK protein network | https://string-db.org/network/866895.HBHAL_2241 | Competence protein ComK. |
| CCG44595.1 protein network | https://string-db.org/network/866895.HBHAL_2242 | Conserved hypothetical protein. |
| yhjE protein network | https://string-db.org/network/866895.HBHAL_2243 | Conserved hypothetical protein. |
| sipT3 protein network | https://string-db.org/network/866895.HBHAL_2244 | Signal peptidase I; Belongs to the peptidase S26 family. |
| addB protein network | https://string-db.org/network/866895.HBHAL_2245 | ATP-dependent nuclease subunit B; ATP-dependent DNA helicase; Belongs to the helicase family. AddB/RexB type 1 subfamily. |
| addA protein network | https://string-db.org/network/866895.HBHAL_2246 | ATP-dependent helicase / nuclease subunit A; ATP-dependent DNA helicase. |
| yisB protein network | https://string-db.org/network/866895.HBHAL_2247 | Hypothetical protein. |
| yyaS4 protein network | https://string-db.org/network/866895.HBHAL_2248 | Conserved hypothetical protein. |
| CCG44602.1 protein network | https://string-db.org/network/866895.HBHAL_2249 | Hypothetical protein. |
| CCG44603.1 protein network | https://string-db.org/network/866895.HBHAL_2250 | IS1341-type transposase. |
| CCG44604.1 protein network | https://string-db.org/network/866895.HBHAL_2251 | LacI family transcription regulator. |
| CCG44605.1 protein network | https://string-db.org/network/866895.HBHAL_2252 | PTS system subunit IIBC, sucrose-specific. |
| CCG44606.1 protein network | https://string-db.org/network/866895.HBHAL_2253 | Sucrose-6-phosphate hydrolase; Enables the bacterium to metabolize sucrose as a sole carbon source; Belongs to the glycosyl hydrolase 32 family. |
| CCG44607.1 protein network | https://string-db.org/network/866895.HBHAL_2254 | Conserved hypothetical protein. |
| CCG44608.1 protein network | https://string-db.org/network/866895.HBHAL_2255 | Putative spore germination protein. |
| CCG44609.1 protein network | https://string-db.org/network/866895.HBHAL_2256 | Hypothetical protein. |
| CCG44610.1 protein network | https://string-db.org/network/866895.HBHAL_2257 | Putative spore germination protein. |
| CCG44611.1 protein network | https://string-db.org/network/866895.HBHAL_2259 | Hypothetical protein. |
| CCG44612.1 protein network | https://string-db.org/network/866895.HBHAL_2261 | Hypothetical protein. |
| yxaH protein network | https://string-db.org/network/866895.HBHAL_2262 | Conserved hypothetical protein. |
| CCG44614.1 protein network | https://string-db.org/network/866895.HBHAL_2263 | Conserved hypothetical protein. |
| CCG44615.1 protein network | https://string-db.org/network/866895.HBHAL_2264 | Conserved hypothetical protein. |
| rocD protein network | https://string-db.org/network/866895.HBHAL_2265 | Ornithine aminotransferase; Catalyzes the interconversion of ornithine to glutamate semialdehyde. |
| yisL protein network | https://string-db.org/network/866895.HBHAL_2266 | Hypothetical protein. |
| CCG44618.1 protein network | https://string-db.org/network/866895.HBHAL_2267 | Hypothetical protein. |
| asnO protein network | https://string-db.org/network/866895.HBHAL_2268 | Asparagine synthase. |
| CCG44620.1 protein network | https://string-db.org/network/866895.HBHAL_2269 | Alpha-amylase family protein. |
| CCG44621.1 protein network | https://string-db.org/network/866895.HBHAL_2271 | Conserved hypothetical protein. |
| degV1 protein network | https://string-db.org/network/866895.HBHAL_2272 | DegV family protein. |
| yitT protein network | https://string-db.org/network/866895.HBHAL_2273 | UPF0750 family protein. |
| CCG44624.1 protein network | https://string-db.org/network/866895.HBHAL_2274 | Intracellular proteinase inhibitor. |
| CCG44625.1 protein network | https://string-db.org/network/866895.HBHAL_2275 | Conserved hypothetical protein. |
| CCG44626.1 protein network | https://string-db.org/network/866895.HBHAL_2276 | Hypothetical protein. |
| CCG44627.1 protein network | https://string-db.org/network/866895.HBHAL_2277 | Hypothetical protein. |
| CCG44628.1 protein network | https://string-db.org/network/866895.HBHAL_2278 | HAD superfamily hydrolase. |
| CCG44629.1 protein network | https://string-db.org/network/866895.HBHAL_2279 | Hypothetical protein. |
| CCG44630.1 protein network | https://string-db.org/network/866895.HBHAL_2281 | Hypothetical protein. |
| CCG44631.1 protein network | https://string-db.org/network/866895.HBHAL_2282 | Hypothetical protein. |
| CCG44632.1 protein network | https://string-db.org/network/866895.HBHAL_2283 | HAD superfamily hydrolase. |
| yitV protein network | https://string-db.org/network/866895.HBHAL_2284 | Conserved hypothetical protein. |
| yitW protein network | https://string-db.org/network/866895.HBHAL_2285 | Hypothetical protein. |
| mobB protein network | https://string-db.org/network/866895.HBHAL_2286 | Molybdopterin-guanine dinucleotide biosynthesis protein MobB. |
| moaE protein network | https://string-db.org/network/866895.HBHAL_2287 | Molybdopterin converting factor subunit 2. |
| moaD protein network | https://string-db.org/network/866895.HBHAL_2288 | Molybdopterin synthase sulfur carrier subunit MoaD. |
| uppP2 protein network | https://string-db.org/network/866895.HBHAL_2289 | Undecaprenyl pyrophosphate phosphatase; Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin; Belongs to the UppP family. |
| CCG44639.1 protein network | https://string-db.org/network/866895.HBHAL_2290 | Hypothetical protein. |
| CCG44640.1 protein network | https://string-db.org/network/866895.HBHAL_2291 | Hypothetical protein. |
| med protein network | https://string-db.org/network/866895.HBHAL_2292 | Positive regulator of ComK. |
| CCG44642.1 protein network | https://string-db.org/network/866895.HBHAL_2293 | Hypothetical protein. |
| CCG44643.1 protein network | https://string-db.org/network/866895.HBHAL_2294 | Hypothetical protein. |
| fabH protein network | https://string-db.org/network/866895.HBHAL_2295 | 3-oxoacyl-(acyl carrier protein) synthase III; Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first [...] |
| fabF protein network | https://string-db.org/network/866895.HBHAL_2296 | 3-oxoacyl-(acyl carrier protein) synthase II; Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. |
| CCG44646.1 protein network | https://string-db.org/network/866895.HBHAL_2298 | LytR family transcription regulator. |
| CCG44647.1 protein network | https://string-db.org/network/866895.HBHAL_2299 | Hypothetical protein. |
| yjbA protein network | https://string-db.org/network/866895.HBHAL_2300 | Hypothetical protein. |
| trpS protein network | https://string-db.org/network/866895.HBHAL_2301 | tryptophanyl-tRNA synthetase; Catalyzes the attachment of tryptophan to tRNA(Trp). Belongs to the class-I aminoacyl-tRNA synthetase family. |
| CCG44650.1 protein network | https://string-db.org/network/866895.HBHAL_2302 | Hypothetical protein. |
| CCG44651.1 protein network | https://string-db.org/network/866895.HBHAL_2303 | ABC-type transport system extracellular binding protein (probable substrate peptide/nickel). |
| CCG44652.1 protein network | https://string-db.org/network/866895.HBHAL_2304 | ABC-type transport system permease protein (probable substrate peptide/nickel). |
| CCG44653.1 protein network | https://string-db.org/network/866895.HBHAL_2305 | ABC-type transport system permease protein (probable substrate peptide/nickel). |
| CCG44654.1 protein network | https://string-db.org/network/866895.HBHAL_2306 | ABC-type transport system ATP-binding protein (probable substrate peptide/nickel); Belongs to the ABC transporter superfamily. |
| CCG44655.1 protein network | https://string-db.org/network/866895.HBHAL_2307 | ABC-type transport system ATP-binding protein (probable substrate peptide/nickel); Belongs to the ABC transporter superfamily. |
| CCG44656.1 protein network | https://string-db.org/network/866895.HBHAL_2309 | IS150-type transposase orfAB. |
| CCG44657.1 protein network | https://string-db.org/network/866895.HBHAL_2310 | Hypothetical protein. |
| yjbC protein network | https://string-db.org/network/866895.HBHAL_2312 | Hypothetical protein. |
| spxA protein network | https://string-db.org/network/866895.HBHAL_2313 | Transcription regulator Spx; Interferes with activator-stimulated transcription by interaction with the RNA polymerase alpha-CTD. May function to globally reduce transcription of genes involved i [...] |
| CCG44661.1 protein network | https://string-db.org/network/866895.HBHAL_2314 | Conserved hypothetical protein. |
| mecA protein network | https://string-db.org/network/866895.HBHAL_2315 | Adaptor protein; Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis. Acts negatively in the development of [...] |
| yjbF protein network | https://string-db.org/network/866895.HBHAL_2316 | Hypothetical protein. |
| pepF protein network | https://string-db.org/network/866895.HBHAL_2317 | Probable peptidase (homolog to oligoendopeptidase F). |
| CCG44665.1 protein network | https://string-db.org/network/866895.HBHAL_2318 | Hypothetical protein. |
| CCG44666.1 protein network | https://string-db.org/network/866895.HBHAL_2319 | Hypothetical protein. |
| CCG44667.1 protein network | https://string-db.org/network/866895.HBHAL_2320 | Hypothetical protein. |
| CCG44668.1 protein network | https://string-db.org/network/866895.HBHAL_2321 | Hypothetical protein. |
| yjbH protein network | https://string-db.org/network/866895.HBHAL_2322 | Hypothetical protein. |
| yjbI protein network | https://string-db.org/network/866895.HBHAL_2323 | Globin. |
| CCG44671.1 protein network | https://string-db.org/network/866895.HBHAL_2324 | CYTH domain protein. |
| CCG44672.1 protein network | https://string-db.org/network/866895.HBHAL_2325 | GTP pyrophosphokinase. |
| ppnK1 protein network | https://string-db.org/network/866895.HBHAL_2326 | Inorganic polyphosphate/ATP-NAD kinase; Involved in the regulation of the intracellular balance of NAD and NADP, and is a key enzyme in the biosynthesis of NADP. Catalyzes specifically the phosph [...] |
| rluD2 protein network | https://string-db.org/network/866895.HBHAL_2327 | Pseudouridine synthase; Responsible for synthesis of pseudouridine from uracil. Belongs to the pseudouridine synthase RluA family. |
| prpA protein network | https://string-db.org/network/866895.HBHAL_2328 | Serine/threonine protein phosphatase; Asymmetrically hydrolyzes Ap4p to yield AMP and ATP. |
| CCG44676.1 protein network | https://string-db.org/network/866895.HBHAL_2329 | Cell cycle protein; Belongs to the SEDS family. |
| CCG44677.1 protein network | https://string-db.org/network/866895.HBHAL_2330 | MgtE family transporter (probable substrate magnesium); Acts as a magnesium transporter. |
| CCG44678.1 protein network | https://string-db.org/network/866895.HBHAL_2331 | Na+/H+ antiporter family protein; Belongs to the monovalent cation:proton antiporter 2 (CPA2) transporter (TC 2.A.37) family. |
| CCG44679.1 protein network | https://string-db.org/network/866895.HBHAL_2332 | Hypothetical protein. |
| CCG44680.1 protein network | https://string-db.org/network/866895.HBHAL_2333 | Hypothetical protein. |
| CCG44681.1 protein network | https://string-db.org/network/866895.HBHAL_2334 | Alpha/beta fold hydrolase. |
| CCG44682.1 protein network | https://string-db.org/network/866895.HBHAL_2335 | Group 2 glycosyltransferase. |
| CCG44683.1 protein network | https://string-db.org/network/866895.HBHAL_2336 | Conserved hypothetical protein. |
| CCG44684.1 protein network | https://string-db.org/network/866895.HBHAL_2338 | Hypothetical protein. |
| CCG44685.1 protein network | https://string-db.org/network/866895.HBHAL_2339 | Hypothetical protein. |
| CCG44686.1 protein network | https://string-db.org/network/866895.HBHAL_2340 | Hypothetical protein. |
| CCG44687.1 protein network | https://string-db.org/network/866895.HBHAL_2341 | Hypothetical protein. |
| CCG44688.1 protein network | https://string-db.org/network/866895.HBHAL_2342 | Hypothetical protein. |
| CCG44689.1 protein network | https://string-db.org/network/866895.HBHAL_2343 | Hypothetical protein. |
| CCG44690.1 protein network | https://string-db.org/network/866895.HBHAL_2344 | Hypothetical protein. |
| CCG44691.1 protein network | https://string-db.org/network/866895.HBHAL_2345 | Enoyl-(acyl carrier protein) reductase. |
| CCG44692.1 protein network | https://string-db.org/network/866895.HBHAL_2346 | Hypothetical protein. |
| CCG44693.1 protein network | https://string-db.org/network/866895.HBHAL_2347 | Spore coat protein. |
| CCG44694.1 protein network | https://string-db.org/network/866895.HBHAL_2348 | Hypothetical protein. |
| CCG44695.1 protein network | https://string-db.org/network/866895.HBHAL_2349 | Hypothetical protein. |
| yngL protein network | https://string-db.org/network/866895.HBHAL_2350 | Hypothetical protein. |
| CCG44697.1 protein network | https://string-db.org/network/866895.HBHAL_2351 | Hypothetical protein. |
| CCG44698.1 protein network | https://string-db.org/network/866895.HBHAL_2352 | Hypothetical protein. |
| CCG44699.1 protein network | https://string-db.org/network/866895.HBHAL_2353 | Hypothetical protein. |
| CCG44700.1 protein network | https://string-db.org/network/866895.HBHAL_2354 | Beta-lactamase domain protein. |
| yetF protein network | https://string-db.org/network/866895.HBHAL_2355 | Hypothetical protein. |
| CCG44702.1 protein network | https://string-db.org/network/866895.HBHAL_2356 | Acetyltransferase, GNAT family. |
| yjcG protein network | https://string-db.org/network/866895.HBHAL_2357 | UPF0477 family protein; Belongs to the 2H phosphoesterase superfamily. YjcG family. |
| yjcH protein network | https://string-db.org/network/866895.HBHAL_2358 | Conserved hypothetical protein. |
| CCG44705.1 protein network | https://string-db.org/network/866895.HBHAL_2359 | M10 family peptidase. |
| CCG44706.1 protein network | https://string-db.org/network/866895.HBHAL_2360 | Hypothetical protein. |
| CCG44707.1 protein network | https://string-db.org/network/866895.HBHAL_2361 | Hypothetical protein. |
| CCG44708.1 protein network | https://string-db.org/network/866895.HBHAL_2362 | Conserved hypothetical protein. |
| CCG44709.1 protein network | https://string-db.org/network/866895.HBHAL_2363 | Hypothetical protein. |
| CCG44710.1 protein network | https://string-db.org/network/866895.HBHAL_2364 | Hypothetical protein. |
| degV2 protein network | https://string-db.org/network/866895.HBHAL_2365 | DegV family protein. |
| CCG44714.1 protein network | https://string-db.org/network/866895.HBHAL_2368 | Conserved hypothetical protein. |
| CCG44715.1 protein network | https://string-db.org/network/866895.HBHAL_2369 | Conserved hypothetical protein. |
| hisC protein network | https://string-db.org/network/866895.HBHAL_2370 | Histidinol-phosphate aminotransferase; Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. Histidinol-phosphate aminotransferase subfamily. |
| pdhA1 protein network | https://string-db.org/network/866895.HBHAL_2371 | Pyruvate dehydrogenase subunit E1-alpha; The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic co [...] |
| pdhB1 protein network | https://string-db.org/network/866895.HBHAL_2372 | Pyruvate dehydrogenase subunit E1-beta. |
| CCG44719.1 protein network | https://string-db.org/network/866895.HBHAL_2373 | Pyruvate dehydrogenase subunit E2. |
| CCG44720.1 protein network | https://string-db.org/network/866895.HBHAL_2374 | Na+/H+ antiporter family protein. |
| CCG44721.1 protein network | https://string-db.org/network/866895.HBHAL_2375 | Conserved hypothetical protein. |
| hpaG1 protein network | https://string-db.org/network/866895.HBHAL_2376 | 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase subunit HpaG1. |
| hpaG2 protein network | https://string-db.org/network/866895.HBHAL_2377 | 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase subunit HpaG2. |
| hpcD protein network | https://string-db.org/network/866895.HBHAL_2378 | 5-carboxymethyl-2-hydroxymuconate delta-isomerase. |
| HBHAL_2381 protein network | https://string-db.org/network/866895.HBHAL_2381 | Locus_tag: HBHAL_2380; product: SSS family transporter (nonfunctional); gene has a frameshift; conceptual translation after in silico reconstruction: MNLSVLIPLCLAYMAVMSLLAYYGYKKTTSEADYLVGGRNINPVV [...] |
| CCG44727.1 protein network | https://string-db.org/network/866895.HBHAL_2382 | 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| hpaB protein network | https://string-db.org/network/866895.HBHAL_2383 | 4-hydroxyphenylacetate-3-hydroxylase. |
| hpaD protein network | https://string-db.org/network/866895.HBHAL_2384 | 3,4-dihydroxyphenylacetate 2,3-dioxygenase. |
| CCG44730.1 protein network | https://string-db.org/network/866895.HBHAL_2385 | Flavin reductase domain protein FMN-binding. |
| CCG44731.1 protein network | https://string-db.org/network/866895.HBHAL_2386 | Bifunctional riboflavin kinase / FMN adenylyltransferase. |
| dapA1 protein network | https://string-db.org/network/866895.HBHAL_2387 | Dihydrodipicolinate synthase; Catalyzes the condensation of (S)-aspartate-beta-semialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA). |
| CCG44733.1 protein network | https://string-db.org/network/866895.HBHAL_2388 | Hypothetical protein. |
| CCG44734.1 protein network | https://string-db.org/network/866895.HBHAL_2389 | Putative carboxypeptidase. |
| CCG44735.1 protein network | https://string-db.org/network/866895.HBHAL_2390 | Conserved hypothetical protein. |
| HBHAL_2392 protein network | https://string-db.org/network/866895.HBHAL_2392 | Locus_tag: HBHAL_2391; product: potassium channel protein (nonfunctional); gene has a frameshift and is truncated at the N-terminus; conceptual translation after in silico reconstruction: AYESTLF [...] |
| CCG44738.1 protein network | https://string-db.org/network/866895.HBHAL_2393 | 4-aminobutyrate aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. |
| gabD protein network | https://string-db.org/network/866895.HBHAL_2394 | Succinate-semialdehyde dehydrogenase. |
| CCG44740.1 protein network | https://string-db.org/network/866895.HBHAL_2395 | Hypothetical protein. |
| CCG44741.1 protein network | https://string-db.org/network/866895.HBHAL_2396 | Sodium/panthothenate symporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| amaB protein network | https://string-db.org/network/866895.HBHAL_2397 | Allantoate amidohydrolase. |
| argE protein network | https://string-db.org/network/866895.HBHAL_2398 | Acetylornithine deacetylase. |
| CCG44745.1 protein network | https://string-db.org/network/866895.HBHAL_2400 | Conserved hypothetical protein. |
| CCG44746.1 protein network | https://string-db.org/network/866895.HBHAL_2401 | Amino acid permease-associated region. |
| CCG44747.1 protein network | https://string-db.org/network/866895.HBHAL_2402 | Conserved hypothetical protein. |
| CCG44748.1 protein network | https://string-db.org/network/866895.HBHAL_2403 | Hypothetical protein. |
| CCG44749.1 protein network | https://string-db.org/network/866895.HBHAL_2404 | Hypothetical protein. |
| CCG44750.1 protein network | https://string-db.org/network/866895.HBHAL_2405 | Hypothetical protein. |
| CCG44751.1 protein network | https://string-db.org/network/866895.HBHAL_2406 | Hypothetical protein. |
| fliC protein network | https://string-db.org/network/866895.HBHAL_2407 | Flagellin; Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella. |
| CCG44753.1 protein network | https://string-db.org/network/866895.HBHAL_2408 | Conserved hypothetical protein. |
| CCG44754.1 protein network | https://string-db.org/network/866895.HBHAL_2409 | Diguanylate cyclase domain protein. |
| mqo-2 protein network | https://string-db.org/network/866895.HBHAL_2410 | Malate dehydrogenase (quinone). |
| CCG44756.1 protein network | https://string-db.org/network/866895.HBHAL_2411 | L-lactate permease family transporter; Transports L-lactate across the membrane. Can also transport D-lactate and glycolate; Belongs to the lactate permease family. |
| gsiB protein network | https://string-db.org/network/866895.HBHAL_2412 | General stress protein. |
| CCG44758.1 protein network | https://string-db.org/network/866895.HBHAL_2413 | Conserved hypothetical protein. |
| CCG44759.1 protein network | https://string-db.org/network/866895.HBHAL_2414 | Conserved hypothetical protein. |
| CCG44760.1 protein network | https://string-db.org/network/866895.HBHAL_2415 | Conserved hypothetical protein. |
| traI protein network | https://string-db.org/network/866895.HBHAL_2416 | DNA topoisomerase III. |
| CCG44762.1 protein network | https://string-db.org/network/866895.HBHAL_2417 | Hypothetical protein. |
| CCG44763.1 protein network | https://string-db.org/network/866895.HBHAL_2418 | Hypothetical protein; Belongs to the TelA family. |
| CCG44764.1 protein network | https://string-db.org/network/866895.HBHAL_2419 | Hypothetical protein. |
| CCG44765.1 protein network | https://string-db.org/network/866895.HBHAL_2420 | Conserved hypothetical protein. |
| CCG44766.1 protein network | https://string-db.org/network/866895.HBHAL_2421 | Heavy metal-transporting P-type ATPase. |
| CCG44767.1 protein network | https://string-db.org/network/866895.HBHAL_2422 | Hypothetical protein. |
| CCG44768.1 protein network | https://string-db.org/network/866895.HBHAL_2423 | Sulfate transporter familiy protein. |
| CCG44769.1 protein network | https://string-db.org/network/866895.HBHAL_2424 | UDP-glucose/GDP-mannose dehydrogenase; Belongs to the UDP-glucose/GDP-mannose dehydrogenase family. |
| CCG44770.1 protein network | https://string-db.org/network/866895.HBHAL_2425 | Glutamine--scyllo-inositol aminotransferase; Belongs to the DegT/DnrJ/EryC1 family. |
| CCG44771.1 protein network | https://string-db.org/network/866895.HBHAL_2426 | Oxidoreductase domain protein. |
| CCG44772.1 protein network | https://string-db.org/network/866895.HBHAL_2427 | Transferase hexapeptide repeat containing protein. |
| CCG44774.1 protein network | https://string-db.org/network/866895.HBHAL_2429 | Hypothetical protein. |
| CCG44775.1 protein network | https://string-db.org/network/866895.HBHAL_2430 | Hypothetical protein. |
| CCG44776.1 protein network | https://string-db.org/network/866895.HBHAL_2432 | Hypothetical protein. |
| CCG44777.1 protein network | https://string-db.org/network/866895.HBHAL_2433 | Hypothetical protein. |
| CCG44778.1 protein network | https://string-db.org/network/866895.HBHAL_2434 | Hypothetical protein. |
| CCG44779.1 protein network | https://string-db.org/network/866895.HBHAL_2435 | Group 2 glycosyltransferase. |
| CCG44780.1 protein network | https://string-db.org/network/866895.HBHAL_2436 | Group 1 glycosyltransferase. |
| CCG44781.1 protein network | https://string-db.org/network/866895.HBHAL_2437 | ABC-type transport system permease protein. |
| CCG44782.1 protein network | https://string-db.org/network/866895.HBHAL_2438 | ABC-type transport system ATP-binding protein. |
| CCG44783.1 protein network | https://string-db.org/network/866895.HBHAL_2439 | Hypothetical protein. |
| dhlB protein network | https://string-db.org/network/866895.HBHAL_2440 | Haloacid dehalogenase, type II. |
| CCG44785.1 protein network | https://string-db.org/network/866895.HBHAL_2441 | CRP/FNR family transcription regulator. |
| yqgS2 protein network | https://string-db.org/network/866895.HBHAL_2442 | YqgS family protein; Belongs to the LTA synthase family. |
| CCG44788.1 protein network | https://string-db.org/network/866895.HBHAL_2444 | Hypothetical protein. |
| CCG44789.1 protein network | https://string-db.org/network/866895.HBHAL_2445 | Hypothetical protein. |
| uspA2 protein network | https://string-db.org/network/866895.HBHAL_2446 | UspA domain protein. |
| CCG44791.1 protein network | https://string-db.org/network/866895.HBHAL_2447 | Sulfate transporter familiy protein. |
| uspA3 protein network | https://string-db.org/network/866895.HBHAL_2448 | UspA domain protein. |
| CCG44793.1 protein network | https://string-db.org/network/866895.HBHAL_2449 | DNA binding domain, excisionase family. |
| CCG44794.1 protein network | https://string-db.org/network/866895.HBHAL_2450 | DedA family protein. |
| CCG44795.1 protein network | https://string-db.org/network/866895.HBHAL_2451 | Na+/Ca2+ antiporter family protein. |
| CCG44796.1 protein network | https://string-db.org/network/866895.HBHAL_2452 | Hypothetical protein. |
| CCG44797.1 protein network | https://string-db.org/network/866895.HBHAL_2453 | Conserved hypothetical protein. |
| mtnN2 protein network | https://string-db.org/network/866895.HBHAL_2454 | 5'-methylthioadenosine/ S-adenosylhomocysteinenucleosidase; Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) [...] |
| HBHAL_2460 protein network | https://string-db.org/network/866895.HBHAL_2460 | Locus_tag: HBHAL_2459; product: putative cyclic nucleotide binding regulatory protein (nonfunctional); gene has a frameshift; conceptual translation after in silico reconstruction: MKDVLIQYMKRFSD [...] |
| ppdK protein network | https://string-db.org/network/866895.HBHAL_2461 | Pyruvate, phosphate dikinase; Belongs to the PEP-utilizing enzyme family. |
| yqfL2 protein network | https://string-db.org/network/866895.HBHAL_2462 | Probable phosphotransferase YqfL; Bifunctional serine/threonine kinase and phosphorylase involved in the regulation of the pyruvate, phosphate dikinase (PPDK) by catalyzing its phosphorylation/de [...] |
| pfkA1 protein network | https://string-db.org/network/866895.HBHAL_2463 | 6-phosphofructokinase; Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis; Belongs to the phosphofructokinase typ [...] |
| CCG44808.1 protein network | https://string-db.org/network/866895.HBHAL_2465 | Hypothetical protein. |
| CCG44809.1 protein network | https://string-db.org/network/866895.HBHAL_2466 | Hypothetical protein. |
| CCG44810.1 protein network | https://string-db.org/network/866895.HBHAL_2467 | ABC-type transport system extracellular binding protein (probable substrate Mn/Zn); Belongs to the bacterial solute-binding protein 9 family. |
| CCG44811.1 protein network | https://string-db.org/network/866895.HBHAL_2468 | Hypothetical protein. |
| CCG44812.1 protein network | https://string-db.org/network/866895.HBHAL_2469 | CopC domain protein. |
| CCG44813.1 protein network | https://string-db.org/network/866895.HBHAL_2470 | Transport protein (probable substrate copper). |
| sodF protein network | https://string-db.org/network/866895.HBHAL_2471 | Superoxide dismutase (Fe). |
| ybbC protein network | https://string-db.org/network/866895.HBHAL_2473 | O-glycosyl hydrolase family protein (homolog to N-acetylglucosaminidase); Belongs to the glycosyl hydrolase 3 family. |
| CCG44817.1 protein network | https://string-db.org/network/866895.HBHAL_2474 | Hypothetical protein. |
| CCG44818.1 protein network | https://string-db.org/network/866895.HBHAL_2475 | ABC-type transport system extracellular binding protein. |
| CCG44819.1 protein network | https://string-db.org/network/866895.HBHAL_2476 | ABC-type transport system permease protein. |
| CCG44820.1 protein network | https://string-db.org/network/866895.HBHAL_2477 | ABC-type transport system permease protein. |
| malL1 protein network | https://string-db.org/network/866895.HBHAL_2478 | Oligo-1,6-glucosidase. |
| CCG44823.1 protein network | https://string-db.org/network/866895.HBHAL_2480 | Hypothetical protein. |
| CCG44824.1 protein network | https://string-db.org/network/866895.HBHAL_2481 | Hypothetical protein. |
| CCG44825.1 protein network | https://string-db.org/network/866895.HBHAL_2482 | Hypothetical protein. |
| CCG44829.1 protein network | https://string-db.org/network/866895.HBHAL_2486 | Hypothetical protein. |
| CCG44830.1 protein network | https://string-db.org/network/866895.HBHAL_2487 | Hypothetical protein. |
| CCG44831.1 protein network | https://string-db.org/network/866895.HBHAL_2488 | Hypothetical protein. |
| CCG44832.1 protein network | https://string-db.org/network/866895.HBHAL_2488_A | Conserved hypothetical protein. |
| CCG44833.1 protein network | https://string-db.org/network/866895.HBHAL_2489 | Group II intron reverse transcriptase/maturase. |
| CCG44835.1 protein network | https://string-db.org/network/866895.HBHAL_2491 | Hypothetical protein. |
| CCG44836.1 protein network | https://string-db.org/network/866895.HBHAL_2492 | Hypothetical protein. |
| CCG44837.1 protein network | https://string-db.org/network/866895.HBHAL_2493 | Group II intron reverse transcriptase/maturase. |
| CCG44838.1 protein network | https://string-db.org/network/866895.HBHAL_2494 | Hypothetical protein. |
| CCG44839.1 protein network | https://string-db.org/network/866895.HBHAL_2495 | Hypothetical protein. |
| CCG44844.1 protein network | https://string-db.org/network/866895.HBHAL_2500 | Hypothetical protein. |
| CCG44845.1 protein network | https://string-db.org/network/866895.HBHAL_2501 | Hypothetical protein. |
| CCG44846.1 protein network | https://string-db.org/network/866895.HBHAL_2502 | Hypothetical protein. |
| CCG44847.1 protein network | https://string-db.org/network/866895.HBHAL_2503 | Hypothetical protein. |
| CCG44848.1 protein network | https://string-db.org/network/866895.HBHAL_2504 | Hypothetical protein. |
| CCG44850.1 protein network | https://string-db.org/network/866895.HBHAL_2505_A | Conserved hypothetical protein. |
| CCG44851.1 protein network | https://string-db.org/network/866895.HBHAL_2506 | Hypothetical protein. |
| CCG44852.1 protein network | https://string-db.org/network/866895.HBHAL_2507 | Hypothetical protein. |
| CCG44853.1 protein network | https://string-db.org/network/866895.HBHAL_2508 | Hypothetical protein. |
| CCG44857.1 protein network | https://string-db.org/network/866895.HBHAL_2512 | Hypothetical protein. |
| yckC2 protein network | https://string-db.org/network/866895.HBHAL_2513 | RDD domain protein. |
| CCG44860.1 protein network | https://string-db.org/network/866895.HBHAL_2515 | Group II intron reverse transcriptase/maturase. |
| CCG44861.1 protein network | https://string-db.org/network/866895.HBHAL_2516_A | Conserved hypothetical protein. |
| CCG44862.1 protein network | https://string-db.org/network/866895.HBHAL_2517 | Phosphatidylserine decarboxylase; Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer). |
| CCG44863.1 protein network | https://string-db.org/network/866895.HBHAL_2518 | Hypothetical protein. |
| CCG44864.1 protein network | https://string-db.org/network/866895.HBHAL_2519 | Conserved hypothetical protein. |
| CCG44865.1 protein network | https://string-db.org/network/866895.HBHAL_2520 | Alpha/beta fold hydrolase. |
| CCG44866.1 protein network | https://string-db.org/network/866895.HBHAL_2521 | Hypothetical protein. |
| CCG44867.1 protein network | https://string-db.org/network/866895.HBHAL_2522 | Conserved hypothetical protein. |
| CCG44868.1 protein network | https://string-db.org/network/866895.HBHAL_2523 | Hypothetical protein. |
| CCG44869.1 protein network | https://string-db.org/network/866895.HBHAL_2524 | Hypothetical protein. |
| CCG44870.1 protein network | https://string-db.org/network/866895.HBHAL_2525 | Hypothetical protein; Belongs to the phosphatidylserine decarboxylase family. |
| CCG44871.1 protein network | https://string-db.org/network/866895.HBHAL_2526 | Hypothetical protein. |
| CCG44872.1 protein network | https://string-db.org/network/866895.HBHAL_2527 | Hypothetical protein. |
| yhjG1 protein network | https://string-db.org/network/866895.HBHAL_2528 | FAD-dependent oxidoreductase. |
| CCG44874.1 protein network | https://string-db.org/network/866895.HBHAL_2529 | Hypothetical protein. |
| CCG44875.1 protein network | https://string-db.org/network/866895.HBHAL_2530 | Hypothetical protein. |
| CCG44876.1 protein network | https://string-db.org/network/866895.HBHAL_2531 | Hypothetical protein. |
| yrkC1 protein network | https://string-db.org/network/866895.HBHAL_2532 | Conserved hypothetical protein. |
| CCG44879.1 protein network | https://string-db.org/network/866895.HBHAL_2534 | Hypothetical protein. |
| CCG44880.1 protein network | https://string-db.org/network/866895.HBHAL_2535 | Conserved hypothetical protein. |
| CCG44881.1 protein network | https://string-db.org/network/866895.HBHAL_2536 | Hypothetical protein. |
| CCG44882.1 protein network | https://string-db.org/network/866895.HBHAL_2536_A | Conserved hypothetical protein. |
| yckC3 protein network | https://string-db.org/network/866895.HBHAL_2537 | RDD domain protein. |
| purT protein network | https://string-db.org/network/866895.HBHAL_2538 | Phosphoribosylglycinamide formyltransferase; Involved in the de novo purine biosynthesis. Catalyzes the transfer of formate to 5-phospho-ribosyl-glycinamide (GAR), producing 5-phospho-ribosyl-N-f [...] |
| CCG44885.1 protein network | https://string-db.org/network/866895.HBHAL_2539 | Hypothetical protein. |
| CCG44887.1 protein network | https://string-db.org/network/866895.HBHAL_2541 | Conserved hypothetical protein. |
| CCG44888.1 protein network | https://string-db.org/network/866895.HBHAL_2542 | Hypothetical protein. |
| CCG44889.1 protein network | https://string-db.org/network/866895.HBHAL_2543 | Conserved hypothetical protein. |
| yrkC2 protein network | https://string-db.org/network/866895.HBHAL_2544 | Conserved hypothetical protein. |
| CCG44891.1 protein network | https://string-db.org/network/866895.HBHAL_2545 | Hypothetical protein. |
| CCG44892.1 protein network | https://string-db.org/network/866895.HBHAL_2546 | Hypothetical protein. |
| CCG44893.1 protein network | https://string-db.org/network/866895.HBHAL_2547 | Hypothetical protein. |
| CCG44894.1 protein network | https://string-db.org/network/866895.HBHAL_2548 | Short-chain dehydrogenase/reductase family protein. |
| CCG44895.1 protein network | https://string-db.org/network/866895.HBHAL_2549 | Hypothetical protein. |
| CCG44896.1 protein network | https://string-db.org/network/866895.HBHAL_2550 | Hypothetical protein. |
| uppP1 protein network | https://string-db.org/network/866895.HBHAL_2551 | Undecaprenyl pyrophosphate phosphatase; Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin; Belongs to the UppP family. |
| CCG44898.1 protein network | https://string-db.org/network/866895.HBHAL_2552 | Conserved hypothetical protein. |
| CCG44899.1 protein network | https://string-db.org/network/866895.HBHAL_2553 | Hypothetical protein. |
| CCG44900.1 protein network | https://string-db.org/network/866895.HBHAL_2554 | Hypothetical protein. |
| CCG44901.1 protein network | https://string-db.org/network/866895.HBHAL_2555 | Hypothetical protein. |
| CCG44902.1 protein network | https://string-db.org/network/866895.HBHAL_2556 | Hypothetical protein. |
| CCG44903.1 protein network | https://string-db.org/network/866895.HBHAL_2557 | Hypothetical protein. |
| azoR protein network | https://string-db.org/network/866895.HBHAL_2558 | FMN-dependent NADH-azoreductase; Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its act [...] |
| CCG44905.1 protein network | https://string-db.org/network/866895.HBHAL_2559 | Oxidoreductase, Gfo/Idh/MocA family. |
| CCG44906.1 protein network | https://string-db.org/network/866895.HBHAL_2560 | Sodium/solute symporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| osmC2 protein network | https://string-db.org/network/866895.HBHAL_2561 | OsmC family protein. |
| CCG44908.1 protein network | https://string-db.org/network/866895.HBHAL_2562 | Putative drug/metabolite exporter family protein. |
| CCG44909.1 protein network | https://string-db.org/network/866895.HBHAL_2563 | Hypothetical protein. |
| CCG44910.1 protein network | https://string-db.org/network/866895.HBHAL_2564 | IS231-type transposase. |
| CCG44911.1 protein network | https://string-db.org/network/866895.HBHAL_2565 | Hypothetical protein. |
| tlpA protein network | https://string-db.org/network/866895.HBHAL_2566 | Methyl-accepting chemotaxis protein. |
| CCG44913.1 protein network | https://string-db.org/network/866895.HBHAL_2567 | Hypothetical protein; Mediates riboflavin uptake, may also transport FMN and roseoflavin. Probably a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporte [...] |
| CCG44914.1 protein network | https://string-db.org/network/866895.HBHAL_2568 | Hypothetical protein. |
| ilvE-2 protein network | https://string-db.org/network/866895.HBHAL_2569 | Branched-chain amino acid aminotransferase; Acts on leucine, isoleucine and valine. Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family. |
| ilvB3 protein network | https://string-db.org/network/866895.HBHAL_2570 | Acetolactate synthase large subunit. |
| ilvH protein network | https://string-db.org/network/866895.HBHAL_2571 | Acetolactate synthase small subunit. |
| ilvC protein network | https://string-db.org/network/866895.HBHAL_2572 | Ketol-acid reductoisomerase; Involved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol-acid reduction of (S)-2-acetolactate (S2AL) to yie [...] |
| leuA protein network | https://string-db.org/network/866895.HBHAL_2573 | 2-isopropylmalate synthase; Catalyzes the condensation of the acetyl group of acetyl-CoA with 3-methyl-2-oxobutanoate (2-oxoisovalerate) to form 3-carboxy-3- hydroxy-4-methylpentanoate (2-isoprop [...] |
| leuB protein network | https://string-db.org/network/866895.HBHAL_2574 | 3-isopropylmalate dehydrogenase; Catalyzes the oxidation of 3-carboxy-2-hydroxy-4- methylpentanoate (3-isopropylmalate) to 3-carboxy-4-methyl-2- oxopentanoate. The product decarboxylates to 4-met [...] |
| leuC protein network | https://string-db.org/network/866895.HBHAL_2575 | 3-isopropylmalate dehydratase large subunit; Catalyzes the isomerization between 2-isopropylmalate and 3- isopropylmalate, via the formation of 2-isopropylmaleate. |
| leuD protein network | https://string-db.org/network/866895.HBHAL_2576 | 3-isopropylmalate dehydratase small subunit; Catalyzes the isomerization between 2-isopropylmalate and 3- isopropylmalate, via the formation of 2-isopropylmaleate. Belongs to the LeuD family. Leu [...] |
| ilvA protein network | https://string-db.org/network/866895.HBHAL_2577 | Threonine ammonia-lyase; Catalyzes the anaerobic formation of alpha-ketobutyrate and ammonia from threonine in a two-step reaction. The first step involved a dehydration of threonine and a produc [...] |
| CCG44924.1 protein network | https://string-db.org/network/866895.HBHAL_2578 | ABC-type transport system extracellular binding protein (probable substrate iron complex). |
| CCG44925.1 protein network | https://string-db.org/network/866895.HBHAL_2579 | ABC-type transport system permease protein (probable substrate iron complex); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily. |
| CCG44926.1 protein network | https://string-db.org/network/866895.HBHAL_2580 | Hypothetical protein. |
| yhjG2 protein network | https://string-db.org/network/866895.HBHAL_2581 | FAD-dependent oxidoreductase. |
| CCG44928.1 protein network | https://string-db.org/network/866895.HBHAL_2582 | Hypothetical protein. |
| CCG44929.1 protein network | https://string-db.org/network/866895.HBHAL_2583 | MarR family transcription regulator. |
| ywoG protein network | https://string-db.org/network/866895.HBHAL_2584 | MFS-type transporter YwoG. |
| ykoY2 protein network | https://string-db.org/network/866895.HBHAL_2585 | TerC family protein. |
| CCG44933.1 protein network | https://string-db.org/network/866895.HBHAL_2587 | Hypothetical protein. |
| CCG44934.1 protein network | https://string-db.org/network/866895.HBHAL_2588 | Hypothetical protein. |
| CCG44936.1 protein network | https://string-db.org/network/866895.HBHAL_2590 | Hypothetical protein. |
| CCG44937.1 protein network | https://string-db.org/network/866895.HBHAL_2591 | Hypothetical protein. |
| CCG44938.1 protein network | https://string-db.org/network/866895.HBHAL_2592 | Hypothetical protein. |
| cwlJ1 protein network | https://string-db.org/network/866895.HBHAL_2593 | Cell wall hydrolase CwlJ. |
| ykkC protein network | https://string-db.org/network/866895.HBHAL_2594 | Small multidrug resistance protein. |
| ykkD protein network | https://string-db.org/network/866895.HBHAL_2595 | Small multidrug resistance protein. |
| CCG44942.1 protein network | https://string-db.org/network/866895.HBHAL_2596 | TetR family transcription regulator. |
| CCG44943.1 protein network | https://string-db.org/network/866895.HBHAL_2597 | Hypothetical protein. |
| yoaS protein network | https://string-db.org/network/866895.HBHAL_2598 | Hypothetical protein. |
| yozG protein network | https://string-db.org/network/866895.HBHAL_2599 | YozG family transcription regulator. |
| yoaT protein network | https://string-db.org/network/866895.HBHAL_2600 | Hypothetical protein. |
| CCG44947.1 protein network | https://string-db.org/network/866895.HBHAL_2601 | Short-chain dehydrogenase/reductase family protein. |
| fbp1 protein network | https://string-db.org/network/866895.HBHAL_2602 | Fructose 1,6-bisphosphatase, class III. |
| CCG44949.1 protein network | https://string-db.org/network/866895.HBHAL_2603 | Conserved hypothetical protein. |
| CCG44950.1 protein network | https://string-db.org/network/866895.HBHAL_2604 | Hypothetical protein. |
| CCG44952.1 protein network | https://string-db.org/network/866895.HBHAL_2606 | Hypothetical protein. |
| ydaH protein network | https://string-db.org/network/866895.HBHAL_2607 | Conserved hypothetical protein; Involved in peptidoglycan biosynthesis. Transports lipid- linked peptidoglycan precursors from the inner to the outer leaflet of the cytoplasmic membrane. |
| HBHAL_2609 protein network | https://string-db.org/network/866895.HBHAL_2609 | Short-chain dehydrogenase/reductase family protein (nonfunctional). |
| yqjT protein network | https://string-db.org/network/866895.HBHAL_2610 | Glyoxalase domain protein. |
| CCG44957.1 protein network | https://string-db.org/network/866895.HBHAL_2611 | Hypothetical protein. |
| CCG44958.1 protein network | https://string-db.org/network/866895.HBHAL_2612 | Hypothetical protein. |
| CCG44959.1 protein network | https://string-db.org/network/866895.HBHAL_2613 | Hypothetical protein. |
| CCG44960.1 protein network | https://string-db.org/network/866895.HBHAL_2614 | IS110-type transposase. |
| HBHAL_2615_B protein network | https://string-db.org/network/866895.HBHAL_2615_B | Locus_tag: HBHAL_2615_A; product: VanZ family protein (nonfunctional); gene has a frameshift; conceptual translation after in silico reconstruction: MQPLGYSYDLSPPLFLIVFTVICGITFLYLHLKNKKKKKNFKKLL [...] |
| CCG44964.1 protein network | https://string-db.org/network/866895.HBHAL_2616 | Hypothetical protein. |
| CCG44965.1 protein network | https://string-db.org/network/866895.HBHAL_2616_A | Conserved hypothetical protein. |
| CCG44966.1 protein network | https://string-db.org/network/866895.HBHAL_2616_B | Conserved hypothetical protein. |
| CCG44967.1 protein network | https://string-db.org/network/866895.HBHAL_2617 | Hypothetical protein. |
| CCG44968.1 protein network | https://string-db.org/network/866895.HBHAL_2618 | Hypothetical protein. |
| CCG44969.1 protein network | https://string-db.org/network/866895.HBHAL_2618_A | Conserved hypothetical protein. |
| CCG44970.1 protein network | https://string-db.org/network/866895.HBHAL_2619 | Hypothetical protein. |
| CCG44971.1 protein network | https://string-db.org/network/866895.HBHAL_2620 | Hypothetical protein. |
| CCG44972.1 protein network | https://string-db.org/network/866895.HBHAL_2621 | Hypothetical protein. |
| CCG44973.1 protein network | https://string-db.org/network/866895.HBHAL_2622 | Hypothetical protein. |
| CCG44974.1 protein network | https://string-db.org/network/866895.HBHAL_2623 | Lactoylglutathione lyase. |
| CCG44975.1 protein network | https://string-db.org/network/866895.HBHAL_2624 | Conserved hypothetical protein. |
| CCG44976.1 protein network | https://string-db.org/network/866895.HBHAL_2625 | Hypothetical protein. |
| CCG44977.1 protein network | https://string-db.org/network/866895.HBHAL_2626 | Zinc-binding alcohol dehydrogenase family protein; Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. |
| dapF protein network | https://string-db.org/network/866895.HBHAL_2627 | Diaminopimelate epimerase; Catalyzes the stereoinversion of LL-2,6-diaminoheptanedioate (L,L-DAP) to meso-diaminoheptanedioate (meso-DAP), a precursor of L- lysine and an essential component of t [...] |
| yugU protein network | https://string-db.org/network/866895.HBHAL_2628 | Hypothetical protein. |
| CCG44981.1 protein network | https://string-db.org/network/866895.HBHAL_2630 | Conserved hypothetical protein. |
| CCG44982.1 protein network | https://string-db.org/network/866895.HBHAL_2631 | LysR family transcription regulator; Belongs to the LysR transcriptional regulatory family. |
| CCG44983.1 protein network | https://string-db.org/network/866895.HBHAL_2632 | Small multidrug resistance protein. |
| yvaE protein network | https://string-db.org/network/866895.HBHAL_2633 | Small multidrug resistance protein. |
| CCG44985.1 protein network | https://string-db.org/network/866895.HBHAL_2634 | Conserved hypothetical protein. |
| CCG44986.1 protein network | https://string-db.org/network/866895.HBHAL_2635 | Hypothetical protein. |
| CCG44987.1 protein network | https://string-db.org/network/866895.HBHAL_2636 | Hypothetical protein. |
| yocH6 protein network | https://string-db.org/network/866895.HBHAL_2637 | Conserved hypothetical protein. |
| CCG44990.1 protein network | https://string-db.org/network/866895.HBHAL_2639 | IS1341-type transposase. |
| zupT protein network | https://string-db.org/network/866895.HBHAL_2640 | Zinc/iron permease family protein; Mediates zinc uptake. May also transport other divalent cations; Belongs to the ZIP transporter (TC 2.A.5) family. ZupT subfamily. |
| iolA protein network | https://string-db.org/network/866895.HBHAL_2641 | Methylmalonic acid semialdehyde dehydrogenase; Catalyzes the oxidation of malonate semialdehyde (MSA) and methylmalonate semialdehyde (MMSA) into acetyl-CoA and propanoyl-CoA, respectively. |
| CCG44993.1 protein network | https://string-db.org/network/866895.HBHAL_2642 | Beta-ureidopropionase. |
| gltB2 protein network | https://string-db.org/network/866895.HBHAL_2643 | Glutamate synthase small subunit. |
| CCG44995.1 protein network | https://string-db.org/network/866895.HBHAL_2644 | Dihydropyrimidine dehydrogenase. |
| pydB protein network | https://string-db.org/network/866895.HBHAL_2645 | Dihydropyrimidinase. |
| CCG44997.1 protein network | https://string-db.org/network/866895.HBHAL_2647 | IS150-type transposase orfAB. |
| CCG44998.1 protein network | https://string-db.org/network/866895.HBHAL_2648 | Nucleobase:cation symporter-1, NCS1 family; Nucleobase/cation symporter-1 family protein (probable substrate cytosine/purines, uracil, thiamine,allantoin). |
| CCG44999.1 protein network | https://string-db.org/network/866895.HBHAL_2649 | Hypothetical protein. |
| CCG45000.1 protein network | https://string-db.org/network/866895.HBHAL_2650 | PucR family transcription regulator. |
| CCG45001.1 protein network | https://string-db.org/network/866895.HBHAL_2651 | Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. |
| ald1 protein network | https://string-db.org/network/866895.HBHAL_2652 | Alanine dehydrogenase; Belongs to the AlaDH/PNT family. |
| CCG45003.1 protein network | https://string-db.org/network/866895.HBHAL_2653 | ArsR family transcription regulator. |
| CCG45004.1 protein network | https://string-db.org/network/866895.HBHAL_2654 | Heavy metal-transporting P-type ATPase (probable substrate cadmium). |
| CCG45005.1 protein network | https://string-db.org/network/866895.HBHAL_2655 | ISL3-type transposase. |
| CCG45006.1 protein network | https://string-db.org/network/866895.HBHAL_2656 | Hypothetical protein. |
| CCG45007.1 protein network | https://string-db.org/network/866895.HBHAL_2657 | Hypothetical protein. |
| CCG45008.1 protein network | https://string-db.org/network/866895.HBHAL_2658 | Hypothetical protein. |
| CCG45009.1 protein network | https://string-db.org/network/866895.HBHAL_2659 | IS1341-type transposase. |
| CCG45010.1 protein network | https://string-db.org/network/866895.HBHAL_2660 | Hypothetical protein. |
| CCG45011.1 protein network | https://string-db.org/network/866895.HBHAL_2661 | ABC-type transport system permease protein. |
| sspH protein network | https://string-db.org/network/866895.HBHAL_2662 | Small acid-soluble spore protein; Belongs to the SspH family. |
| CCG45013.1 protein network | https://string-db.org/network/866895.HBHAL_2663 | Probable glycerol dehydrogenase. |
| mtnX protein network | https://string-db.org/network/866895.HBHAL_2664 | 2-hydroxy-3-keto-5-methylthiopentenyl-1- phosphatephosphatase. |
| CCG45015.1 protein network | https://string-db.org/network/866895.HBHAL_2665 | Peptidoglycan-binding LysM. |
| CCG45016.1 protein network | https://string-db.org/network/866895.HBHAL_2666 | Hypothetical protein. |
| yojL protein network | https://string-db.org/network/866895.HBHAL_2667 | Conserved hypothetical protein. |
| CCG45018.1 protein network | https://string-db.org/network/866895.HBHAL_2668 | Hypothetical protein. |
| CCG45019.1 protein network | https://string-db.org/network/866895.HBHAL_2669 | Hypothetical protein. |
| CCG45020.1 protein network | https://string-db.org/network/866895.HBHAL_2670 | Hypothetical protein. |
| CCG45021.1 protein network | https://string-db.org/network/866895.HBHAL_2671 | Conserved hypothetical protein. |
| CCG45022.1 protein network | https://string-db.org/network/866895.HBHAL_2672 | Conserved hypothetical protein. |
| CCG45024.1 protein network | https://string-db.org/network/866895.HBHAL_2674 | Hypothetical protein. |
| cysH protein network | https://string-db.org/network/866895.HBHAL_2675 | Phosphoadenosine phosphosulfate reductase; Reduction of activated sulfate into sulfite. Belongs to the PAPS reductase family. CysH subfamily. |
| sat1 protein network | https://string-db.org/network/866895.HBHAL_2676 | Sulfate adenylyltransferase; Belongs to the sulfate adenylyltransferase family. |
| cysC1 protein network | https://string-db.org/network/866895.HBHAL_2677 | Adenylylsulfate kinase; Catalyzes the synthesis of activated sulfate. |
| cobA protein network | https://string-db.org/network/866895.HBHAL_2678 | uroporphyrinogen-III C-methyltransferase; Belongs to the precorrin methyltransferase family. |
| sirB protein network | https://string-db.org/network/866895.HBHAL_2679 | Sirohydrochlorin ferrochelatase. |
| sirC protein network | https://string-db.org/network/866895.HBHAL_2680 | Precorrin-2 dehydrogenase. |
| CCG45031.1 protein network | https://string-db.org/network/866895.HBHAL_2681 | Conserved hypothetical protein. |
| CCG45032.1 protein network | https://string-db.org/network/866895.HBHAL_2682 | Sulfite reductase (NADPH) alpha subunit; Component of the sulfite reductase complex that catalyzes the 6-electron reduction of sulfite to sulfide. This is one of several activities required for t [...] |
| cysI protein network | https://string-db.org/network/866895.HBHAL_2683 | Sulfite reductase (NADPH) beta subunit; Component of the sulfite reductase complex that catalyzes the 6-electron reduction of sulfite to sulfide. This is one of several activities required for th [...] |
| yisY protein network | https://string-db.org/network/866895.HBHAL_2685 | AB hydrolase superfamily protein. |
| CCG45036.1 protein network | https://string-db.org/network/866895.HBHAL_2686 | 3-hydroxyisobutyrate dehydrogenase. |
| CCG45037.1 protein network | https://string-db.org/network/866895.HBHAL_2687 | Hypothetical protein. |
| CCG45038.1 protein network | https://string-db.org/network/866895.HBHAL_2688 | Hypothetical protein. |
| CCG45039.1 protein network | https://string-db.org/network/866895.HBHAL_2689 | TetR family transcription regulator. |
| CCG45040.1 protein network | https://string-db.org/network/866895.HBHAL_2690 | ABC-type transport system ATP-binding protein (probable substrate antibiotic). |
| CCG45041.1 protein network | https://string-db.org/network/866895.HBHAL_2691 | ABC-type transport system permease protein (probable substrate antibiotic). |
| CCG45042.1 protein network | https://string-db.org/network/866895.HBHAL_2692 | Hypothetical protein. |
| CCG45043.1 protein network | https://string-db.org/network/866895.HBHAL_2693 | Hypothetical protein. |
| CCG45044.1 protein network | https://string-db.org/network/866895.HBHAL_2694 | Hypothetical protein. |
| CCG45045.1 protein network | https://string-db.org/network/866895.HBHAL_2695 | Hypothetical protein. |
| CCG45046.1 protein network | https://string-db.org/network/866895.HBHAL_2696 | Hypothetical protein. |
| CCG45047.1 protein network | https://string-db.org/network/866895.HBHAL_2697 | Hypothetical protein. |
| CCG45048.1 protein network | https://string-db.org/network/866895.HBHAL_2698 | Oxidoreductase, aldo/keto reductase family. |
| CCG45049.1 protein network | https://string-db.org/network/866895.HBHAL_2699 | Acetyltransferase, GNAT family. |
| yfkA protein network | https://string-db.org/network/866895.HBHAL_2700 | Conserved hypothetical protein. |
| CCG45051.1 protein network | https://string-db.org/network/866895.HBHAL_2701 | Hypothetical protein. |
| CCG45052.1 protein network | https://string-db.org/network/866895.HBHAL_2702 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| CCG45053.1 protein network | https://string-db.org/network/866895.HBHAL_2703 | Alpha/beta fold hydrolase. |
| CCG45054.1 protein network | https://string-db.org/network/866895.HBHAL_2704 | Hypothetical protein. |
| CCG45055.1 protein network | https://string-db.org/network/866895.HBHAL_2705 | Conserved hypothetical protein. |
| yflT protein network | https://string-db.org/network/866895.HBHAL_2706 | Hypothetical protein. |
| fimA protein network | https://string-db.org/network/866895.HBHAL_2707 | Hypothetical protein. |
| CCG45058.1 protein network | https://string-db.org/network/866895.HBHAL_2709 | IS150-type transposase orfAB. |
| CCG45059.1 protein network | https://string-db.org/network/866895.HBHAL_2710 | Hypothetical protein. |
| CCG45060.1 protein network | https://string-db.org/network/866895.HBHAL_2711 | Hypothetical protein. |
| CCG45061.1 protein network | https://string-db.org/network/866895.HBHAL_2712 | Hypothetical protein. |
| CCG45062.1 protein network | https://string-db.org/network/866895.HBHAL_2713 | ArsR family transcription regulator. |
| CCG45063.1 protein network | https://string-db.org/network/866895.HBHAL_2714 | IS1341-type transposase. |
| CCG45064.1 protein network | https://string-db.org/network/866895.HBHAL_2715 | Putative MFS-type transporter. |
| fdhD protein network | https://string-db.org/network/866895.HBHAL_2716 | Protein FdhD homolog; Required for formate dehydrogenase (FDH) activity. Acts as a sulfur carrier protein that transfers sulfur from IscS to the molybdenum cofactor prior to its insertion into FD [...] |
| CCG45066.1 protein network | https://string-db.org/network/866895.HBHAL_2717 | Probable formate dehydrogenase alpha subunit. |
| CCG45067.1 protein network | https://string-db.org/network/866895.HBHAL_2718 | Hypothetical protein. |
| CCG45068.1 protein network | https://string-db.org/network/866895.HBHAL_2719 | Hypothetical protein. |
| CCG45069.1 protein network | https://string-db.org/network/866895.HBHAL_2720 | Hypothetical protein. |
| CCG45070.1 protein network | https://string-db.org/network/866895.HBHAL_2721 | Conserved hypothetical protein. |
| CCG45071.1 protein network | https://string-db.org/network/866895.HBHAL_2722 | Probable oxidoreductase. |
| CCG45072.1 protein network | https://string-db.org/network/866895.HBHAL_2723 | Beta-lactam antibiotic acylase family protein. |
| CCG45073.1 protein network | https://string-db.org/network/866895.HBHAL_2724 | ThiJ/PfpI domain protein. |
| CCG45074.1 protein network | https://string-db.org/network/866895.HBHAL_2725 | Antibiotic biosynthesis monooxygenase. |
| CCG45075.1 protein network | https://string-db.org/network/866895.HBHAL_2726 | Hypothetical protein. |
| CCG45076.1 protein network | https://string-db.org/network/866895.HBHAL_2727 | Glyceraldehyde-3-phosphate dehydrogenase,NADP-dependent; Belongs to the aldehyde dehydrogenase family. |
| CCG45077.1 protein network | https://string-db.org/network/866895.HBHAL_2728 | Na+/H+ antiporter family protein. |
| sir2 protein network | https://string-db.org/network/866895.HBHAL_2729 | NAD-dependent deacetylase. |
| CCG45079.1 protein network | https://string-db.org/network/866895.HBHAL_2730 | FMN-containing NADPH-linked nitro/flavin reductase; Belongs to the flavin oxidoreductase frp family. |
| CCG45081.1 protein network | https://string-db.org/network/866895.HBHAL_2732 | Hypothetical protein. |
| CCG45082.1 protein network | https://string-db.org/network/866895.HBHAL_2733 | ABC-type transport system ATP-binding protein (probable substrate antibiotic). |
| CCG45083.1 protein network | https://string-db.org/network/866895.HBHAL_2734 | ABC-type transport system permease protein (probable substrate antibiotic). |
| CCG45084.1 protein network | https://string-db.org/network/866895.HBHAL_2735 | Oxidoreductase. |
| CCG45085.1 protein network | https://string-db.org/network/866895.HBHAL_2736 | Oxidoreductase domain protein. |
| yoaR protein network | https://string-db.org/network/866895.HBHAL_2737 | VanW family protein. |
| CCG45087.1 protein network | https://string-db.org/network/866895.HBHAL_2738 | Hypothetical protein. |
| yloQ protein network | https://string-db.org/network/866895.HBHAL_2740 | Ribosome-associated GTPase; One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play [...] |
| glnA2 protein network | https://string-db.org/network/866895.HBHAL_2741 | Glutamine synthetase. |
| CCG45090.1 protein network | https://string-db.org/network/866895.HBHAL_2742 | Hypothetical protein. |
| ppaC protein network | https://string-db.org/network/866895.HBHAL_2743 | Putative manganese-dependent inorganic pyrophosphatase. |
| CCG45092.1 protein network | https://string-db.org/network/866895.HBHAL_2744 | Hypothetical protein. |
| CCG45093.1 protein network | https://string-db.org/network/866895.HBHAL_2745 | Acetyltransferase, GNAT family. |
| corA protein network | https://string-db.org/network/866895.HBHAL_2746 | CorA-like magnesium transport protein; Mediates influx of magnesium ions. Belongs to the CorA metal ion transporter (MIT) (TC 1.A.35) family. |
| CCG45095.1 protein network | https://string-db.org/network/866895.HBHAL_2747 | Thioredoxin reductase-like protein. |
| CCG45096.1 protein network | https://string-db.org/network/866895.HBHAL_2748 | Hypothetical protein. |
| CCG45097.1 protein network | https://string-db.org/network/866895.HBHAL_2749 | Short-chain dehydrogenase/reductase family protein. |
| yueE protein network | https://string-db.org/network/866895.HBHAL_2750 | Hypothetical protein. |
| CCG45099.1 protein network | https://string-db.org/network/866895.HBHAL_2751 | Hypothetical protein. |
| CCG45100.1 protein network | https://string-db.org/network/866895.HBHAL_2752 | Hypothetical protein. |
| moeA protein network | https://string-db.org/network/866895.HBHAL_2753 | Molybdopterin biosynthesis protein; Catalyzes the insertion of molybdate into adenylated molybdopterin with the concomitant release of AMP. Belongs to the MoeA family. |
| moaA protein network | https://string-db.org/network/866895.HBHAL_2754 | Molybdenum cofactor biosynthesis protein A; Catalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate. |
| CCG45103.1 protein network | https://string-db.org/network/866895.HBHAL_2755 | IS110-type transposase. |
| CCG45104.1 protein network | https://string-db.org/network/866895.HBHAL_2756 | Alcohol dehydrogenase. |
| CCG45105.1 protein network | https://string-db.org/network/866895.HBHAL_2757 | Conserved hypothetical protein. |
| CCG45106.1 protein network | https://string-db.org/network/866895.HBHAL_2758 | Cation transporter family protein. |
| crtNa protein network | https://string-db.org/network/866895.HBHAL_2760 | Apo-8'-phytoene desaturase. |
| crtNc protein network | https://string-db.org/network/866895.HBHAL_2761 | Probable apo-8'-phytoene desaturase/dehydrogenase. |
| crtM protein network | https://string-db.org/network/866895.HBHAL_2762 | Apo-8'-phytoene synthase. |
| crtNb protein network | https://string-db.org/network/866895.HBHAL_2763 | Probable apo-8'-phytoene desaturase/dehydrogenase. |
| CCG45112.1 protein network | https://string-db.org/network/866895.HBHAL_2764 | Probable hydroxy-3,4-dehydro-apo-8'-lycopene glucosyltransferase. |
| CCG45113.1 protein network | https://string-db.org/network/866895.HBHAL_2765 | Phospholipid/glycerol acyltransferase. |
| CCG45114.1 protein network | https://string-db.org/network/866895.HBHAL_2766 | Conserved hypothetical protein. |
| CCG45115.1 protein network | https://string-db.org/network/866895.HBHAL_2767 | Conserved hypothetical protein. |
| CCG45116.1 protein network | https://string-db.org/network/866895.HBHAL_2768 | Hypothetical protein. |
| CCG45117.1 protein network | https://string-db.org/network/866895.HBHAL_2769 | Hypothetical protein. |
| CCG45118.1 protein network | https://string-db.org/network/866895.HBHAL_2770 | IS231-type transposase. |
| CCG45119.1 protein network | https://string-db.org/network/866895.HBHAL_2771 | Hypothetical protein. |
| sipT1 protein network | https://string-db.org/network/866895.HBHAL_2772 | Signal peptidase I; Belongs to the peptidase S26 family. |
| CCG45121.1 protein network | https://string-db.org/network/866895.HBHAL_2773 | Hypothetical protein. |
| CCG45122.1 protein network | https://string-db.org/network/866895.HBHAL_2774 | Aminotransferase. |
| CCG45123.1 protein network | https://string-db.org/network/866895.HBHAL_2775 | Hypothetical protein. |
| CCG45125.1 protein network | https://string-db.org/network/866895.HBHAL_2777 | Conserved hypothetical protein. |
| CCG45126.1 protein network | https://string-db.org/network/866895.HBHAL_2778 | Hypothetical protein. |
| CCG45127.1 protein network | https://string-db.org/network/866895.HBHAL_2779 | Hypothetical protein. |
| cheV protein network | https://string-db.org/network/866895.HBHAL_2780 | Chemotaxis protein CheV. |
| CCG45129.1 protein network | https://string-db.org/network/866895.HBHAL_2781 | Hypothetical protein. |
| ykyB protein network | https://string-db.org/network/866895.HBHAL_2782 | Hypothetical protein. |
| sco1 protein network | https://string-db.org/network/866895.HBHAL_2783 | Cytochrome c oxidase assembly protein Sco. |
| CCG45132.1 protein network | https://string-db.org/network/866895.HBHAL_2784 | Conserved hypothetical protein. |
| CCG45133.1 protein network | https://string-db.org/network/866895.HBHAL_2785 | Short-chain dehydrogenase/reductase family protein. |
| CCG45134.1 protein network | https://string-db.org/network/866895.HBHAL_2786 | Hemolysin III family protein. |
| CCG45135.1 protein network | https://string-db.org/network/866895.HBHAL_2787 | CBS domain protein. |
| CCG45137.1 protein network | https://string-db.org/network/866895.HBHAL_2789 | MFS-type transporter (probable function drug resistance). |
| dapH protein network | https://string-db.org/network/866895.HBHAL_2790 | Tetrahydrodipicolinate N-acetyltransferase; Catalyzes the transfer of an acetyl group from acetyl-CoA to tetrahydrodipicolinate. |
| CCG45139.1 protein network | https://string-db.org/network/866895.HBHAL_2791 | N-acetyldiaminopimelate deacetylase; Catalyzes the conversion of N-acetyl-diaminopimelate to diaminopimelate and acetate. |
| CCG45140.1 protein network | https://string-db.org/network/866895.HBHAL_2792 | UPF0180 family protein; Belongs to the UPF0180 family. |
| CCG45141.1 protein network | https://string-db.org/network/866895.HBHAL_2793 | DUF21/CBS domain protein. |
| CCG45142.1 protein network | https://string-db.org/network/866895.HBHAL_2794 | Small-conductance mechanosensitive channel. |
| ykuU protein network | https://string-db.org/network/866895.HBHAL_2795 | 2-cys peroxiredoxin. |
| ykuV protein network | https://string-db.org/network/866895.HBHAL_2796 | Thiol-disulfide oxidoreductase YkuV. |
| CCG45145.1 protein network | https://string-db.org/network/866895.HBHAL_2797 | ABC-type transport system ATP-binding/permease protein. |
| CCG45146.1 protein network | https://string-db.org/network/866895.HBHAL_2798 | ABC-type transport system ATP-binding/permease protein. |
| cydA protein network | https://string-db.org/network/866895.HBHAL_2799 | Cytochrome d ubiquinol oxidase subunit I. |
| cydB protein network | https://string-db.org/network/866895.HBHAL_2800 | Cytochrome d ubiquinol oxidase subunit II. |
| CCG45149.1 protein network | https://string-db.org/network/866895.HBHAL_2801 | Potassium uptake protein. |
| ydaP protein network | https://string-db.org/network/866895.HBHAL_2802 | Pyruvate oxidase; Belongs to the TPP enzyme family. |
| rnjA protein network | https://string-db.org/network/866895.HBHAL_2803 | Ribonuclease J; An RNase that has 5'-3' exonuclease and possibly endonuclease activity. Involved in maturation of rRNA and in some organisms also mRNA maturation and/or decay; Belongs to the meta [...] |
| ykzG protein network | https://string-db.org/network/866895.HBHAL_2804 | Hypothetical protein; Belongs to the UPF0356 family. |
| ykrA protein network | https://string-db.org/network/866895.HBHAL_2805 | HAD superfamily hydrolase. |
| def protein network | https://string-db.org/network/866895.HBHAL_2806 | Peptide deformylase; Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a [...] |
| ykyA protein network | https://string-db.org/network/866895.HBHAL_2807 | Hypothetical protein. |
| pdhA2 protein network | https://string-db.org/network/866895.HBHAL_2808 | Pyruvate dehydrogenase subunit E1-alpha; The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic co [...] |
| pdhB2 protein network | https://string-db.org/network/866895.HBHAL_2809 | Pyruvate dehydrogenase subunit E1-beta. |
| CCG45158.1 protein network | https://string-db.org/network/866895.HBHAL_2810 | Dihydrolipoyllysine-residue acetyltransferase. |
| CCG45159.1 protein network | https://string-db.org/network/866895.HBHAL_2811 | Dihydrolipoamide dehydrogenase. |
| CCG45160.1 protein network | https://string-db.org/network/866895.HBHAL_2812 | Hypothetical protein. |
| CCG45161.1 protein network | https://string-db.org/network/866895.HBHAL_2813 | Hypothetical protein. |
| CCG45163.1 protein network | https://string-db.org/network/866895.HBHAL_2815 | BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family. |
| CCG45164.1 protein network | https://string-db.org/network/866895.HBHAL_2816 | UPF0421 family protein. |
| CCG45165.1 protein network | https://string-db.org/network/866895.HBHAL_2817 | Polysaccharide deacetylase. |
| CCG45166.1 protein network | https://string-db.org/network/866895.HBHAL_2818 | Arginine decarboxylase. |
| CCG45167.1 protein network | https://string-db.org/network/866895.HBHAL_2819 | Homolog to 2-nitropropane dioxygenase. |
| yktA protein network | https://string-db.org/network/866895.HBHAL_2820 | Hypothetical protein; Belongs to the UPF0223 family. |
| yktB protein network | https://string-db.org/network/866895.HBHAL_2821 | Hypothetical protein; Belongs to the UPF0637 family. |
| CCG45170.1 protein network | https://string-db.org/network/866895.HBHAL_2822 | Hypothetical protein. |
| suhB protein network | https://string-db.org/network/866895.HBHAL_2823 | Inositol-phosphate phosphatase. |
| CCG45172.1 protein network | https://string-db.org/network/866895.HBHAL_2824 | Hypothetical protein. |
| CCG45173.1 protein network | https://string-db.org/network/866895.HBHAL_2825 | Hypothetical protein. |
| CCG45174.1 protein network | https://string-db.org/network/866895.HBHAL_2826 | Hypothetical protein. |
| CCG45175.1 protein network | https://string-db.org/network/866895.HBHAL_2827 | Conserved hypothetical protein. |
| CCG45176.1 protein network | https://string-db.org/network/866895.HBHAL_2828 | Hypothetical protein. |
| glsA2 protein network | https://string-db.org/network/866895.HBHAL_2829 | Glutaminase; Belongs to the glutaminase family. |
| ylaN protein network | https://string-db.org/network/866895.HBHAL_2830 | Hypothetical protein; Belongs to the UPF0358 family. |
| ftsW protein network | https://string-db.org/network/866895.HBHAL_2831 | Cell-division protein; Belongs to the SEDS family. |
| pyc protein network | https://string-db.org/network/866895.HBHAL_2832 | Pyruvate carboxylase; Catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate [...] |
| ctaB protein network | https://string-db.org/network/866895.HBHAL_2834 | Protoheme IX farnesyltransferase; Converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group; Belongs [...] |
| ctaC protein network | https://string-db.org/network/866895.HBHAL_2835 | Cytochrome c oxidase subunit II; Subunits I and II form the functional core of the enzyme complex. Electrons originating in cytochrome c are transferred via heme a and Cu(A) to the binuclear cent [...] |
| ctaD protein network | https://string-db.org/network/866895.HBHAL_2836 | Cytochrome c oxidase subunit I; Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme [...] |
| ctaE protein network | https://string-db.org/network/866895.HBHAL_2837 | Cytochrome c oxidase subunit III. |
| ctaF protein network | https://string-db.org/network/866895.HBHAL_2838 | Cytochrome c oxidase subunit IV. |
| ctaG protein network | https://string-db.org/network/866895.HBHAL_2839 | Cytochrome c oxidase assembly protein CtaG. |
| CCG45188.1 protein network | https://string-db.org/network/866895.HBHAL_2840 | Conserved hypothetical protein. |
| CCG45189.1 protein network | https://string-db.org/network/866895.HBHAL_2841 | Acetyltransferase, GNAT family. |
| CCG45190.1 protein network | https://string-db.org/network/866895.HBHAL_2842 | UPF0118 family protein. |
| CCG45191.1 protein network | https://string-db.org/network/866895.HBHAL_2843 | Hypothetical protein. |
| CCG45192.1 protein network | https://string-db.org/network/866895.HBHAL_2844 | Hypothetical protein. |
| CCG45193.1 protein network | https://string-db.org/network/866895.HBHAL_2845 | Hypothetical protein. |
| CCG45194.1 protein network | https://string-db.org/network/866895.HBHAL_2846 | Hypothetical protein. |
| CCG45195.1 protein network | https://string-db.org/network/866895.HBHAL_2847 | Hypothetical protein. |
| ylbF protein network | https://string-db.org/network/866895.HBHAL_2848 | Hypothetical protein; Belongs to the UPF0342 family. |
| CCG45197.1 protein network | https://string-db.org/network/866895.HBHAL_2849 | Conserved hypothetical protein. |
| CCG45198.1 protein network | https://string-db.org/network/866895.HBHAL_2850 | UPF0298 family protein. |
| CCG45199.1 protein network | https://string-db.org/network/866895.HBHAL_2851 | Conserved hypothetical protein. |
| CCG45200.1 protein network | https://string-db.org/network/866895.HBHAL_2852 | Putative methyltransferase. |
| coaD protein network | https://string-db.org/network/866895.HBHAL_2853 | Phosphopantetheine adenylyltransferase; Reversibly transfers an adenylyl group from ATP to 4'- phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate. Belongs to the bacterial CoaD [...] |
| CCG45202.1 protein network | https://string-db.org/network/866895.HBHAL_2854 | Conserved hypothetical protein. |
| ylbK protein network | https://string-db.org/network/866895.HBHAL_2855 | NTE family protein. |
| ylbL protein network | https://string-db.org/network/866895.HBHAL_2856 | Conserved hypothetical protein. |
| ylbM protein network | https://string-db.org/network/866895.HBHAL_2857 | Hypothetical protein; Catalyzes the formation of N(4)-acetylcytidine (ac(4)C) at the wobble position of elongator tRNA(Met), using acetate and ATP as substrates. First activates an acetate ion to [...] |
| CCG45206.1 protein network | https://string-db.org/network/866895.HBHAL_2858 | Hypothetical protein. |
| CCG45207.1 protein network | https://string-db.org/network/866895.HBHAL_2859 | Conserved hypothetical protein. |
| rpmF protein network | https://string-db.org/network/866895.HBHAL_2860 | 50S ribosomal protein L32; Belongs to the bacterial ribosomal protein bL32 family. |
| CCG45209.1 protein network | https://string-db.org/network/866895.HBHAL_2861 | enoyl-CoA hydratase / 3-hydroxybutyryl-CoA dehydratase; Belongs to the enoyl-CoA hydratase/isomerase family. |
| CCG45210.1 protein network | https://string-db.org/network/866895.HBHAL_2862 | RsfA family transcription regulator. |
| ylbP protein network | https://string-db.org/network/866895.HBHAL_2863 | Hypothetical protein. |
| CCG45212.1 protein network | https://string-db.org/network/866895.HBHAL_2864 | 2-dehydropantoate 2-reductase; Catalyzes the NADPH-dependent reduction of ketopantoate into pantoic acid. |
| CCG45213.1 protein network | https://string-db.org/network/866895.HBHAL_2865 | Hypothetical protein. |
| bshC protein network | https://string-db.org/network/866895.HBHAL_2866 | Hypothetical protein; Involved in bacillithiol (BSH) biosynthesis. May catalyze the last step of the pathway, the addition of cysteine to glucosamine malate (GlcN-Mal) to generate BSH. |
| mraZ protein network | https://string-db.org/network/866895.HBHAL_2867 | MraZ protein; Belongs to the MraZ family. |
| rsmH protein network | https://string-db.org/network/866895.HBHAL_2868 | S-adenosyl-methyltransferase; Specifically methylates the N4 position of cytidine in position 1402 (C1402) of 16S rRNA. |
| ftsL protein network | https://string-db.org/network/866895.HBHAL_2869 | Hypothetical protein; Essential cell division protein; Belongs to the FtsL family. |
| CCG45218.1 protein network | https://string-db.org/network/866895.HBHAL_2870 | Penicillin binding protein 2B. |
| CCG45219.1 protein network | https://string-db.org/network/866895.HBHAL_2871 | Stage V sporulation protein D (sporulation-specific penicillin binding protein). |
| murE protein network | https://string-db.org/network/866895.HBHAL_2872 | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase; Catalyzes the addition of meso-diaminopimelic acid to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanyl-D-glutamate (U [...] |
| murF protein network | https://string-db.org/network/866895.HBHAL_2873 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase; Involved in cell wall formation. Catalyzes the final step in the synthesis of UDP-N-acetylmuramoyl-pentapeptide, the precursor of mure [...] |
| mraY protein network | https://string-db.org/network/866895.HBHAL_2874 | phospho-N-acetylmuramoyl-pentapeptide- transferase; First step of the lipid cycle reactions in the biosynthesis of the cell wall peptidoglycan; Belongs to the glycosyltransferase 4 family. MraY s [...] |
| murD protein network | https://string-db.org/network/866895.HBHAL_2875 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; Cell wall formation. Catalyzes the addition of glutamate to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanine (UMA). Belongs to the MurCDEF [...] |
| CCG45224.1 protein network | https://string-db.org/network/866895.HBHAL_2876 | Stage V sporulation protein E; Belongs to the SEDS family. |
| divIB protein network | https://string-db.org/network/866895.HBHAL_2877 | Cell-division initiation protein; Cell division protein that may be involved in stabilizing or promoting the assembly of the division complex; Belongs to the FtsQ/DivIB family. DivIB subfamily. |
| ftsA protein network | https://string-db.org/network/866895.HBHAL_2878 | Cell division protein FtsA; Cell division protein that is involved in the assembly of the Z ring. May serve as a membrane anchor for the Z ring. Belongs to the FtsA/MreB family. |
| ftsZ protein network | https://string-db.org/network/866895.HBHAL_2879 | Cell division protein FtsZ; Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the tim [...] |
| CCG45228.1 protein network | https://string-db.org/network/866895.HBHAL_2880 | Sporulation sigma-E factor processing peptidase (stage II sporulation protein GA); Probable aspartic protease that is responsible for the proteolytic cleavage of the RNA polymerase sigma E factor [...] |
| sigE protein network | https://string-db.org/network/866895.HBHAL_2881 | RNA polymerase sigma factor SigE; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. |
| sigG protein network | https://string-db.org/network/866895.HBHAL_2882 | RNA polymerase sigma factor SigG; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. |
| CCG45232.1 protein network | https://string-db.org/network/866895.HBHAL_2884 | Conserved hypothetical protein. |
| ylmD protein network | https://string-db.org/network/866895.HBHAL_2885 | Conserved hypothetical protein; Belongs to the multicopper oxidase YfiH/RL5 family. |
| ylmE protein network | https://string-db.org/network/866895.HBHAL_2886 | UPF0001 family protein; Pyridoxal 5'-phosphate (PLP)-binding protein, which is involved in PLP homeostasis; Belongs to the pyridoxal phosphate-binding protein YggS/PROSC family. |
| sepF protein network | https://string-db.org/network/866895.HBHAL_2887 | Putative cell division protein SepF; Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cro [...] |
| CCG45236.1 protein network | https://string-db.org/network/866895.HBHAL_2888 | Conserved hypothetical protein. |
| CCG45237.1 protein network | https://string-db.org/network/866895.HBHAL_2889 | Conserved hypothetical protein. |
| CCG45238.1 protein network | https://string-db.org/network/866895.HBHAL_2890 | Cell division initiation protein. |
| CCG45239.1 protein network | https://string-db.org/network/866895.HBHAL_2891 | Hypothetical protein. |
| lspA protein network | https://string-db.org/network/866895.HBHAL_2892 | Lipoprotein signal peptidase; This protein specifically catalyzes the removal of signal peptides from prolipoproteins; Belongs to the peptidase A8 family. |
| rluD3 protein network | https://string-db.org/network/866895.HBHAL_2893 | Pseudouridine synthase; Responsible for synthesis of pseudouridine from uracil. Belongs to the pseudouridine synthase RluA family. |
| pyrR protein network | https://string-db.org/network/866895.HBHAL_2894 | Pyrimidine regulatory protein PyrR; Also displays a weak uracil phosphoribosyltransferase activity which is not physiologically significant; Belongs to the purine/pyrimidine phosphoribosyltransfe [...] |
| pyrP protein network | https://string-db.org/network/866895.HBHAL_2895 | Uracil permease. |
| pyrB protein network | https://string-db.org/network/866895.HBHAL_2896 | Aspartate carbamoyltransferase catalytic subunit; Belongs to the aspartate/ornithine carbamoyltransferase superfamily. ATCase family. |
| pyrC protein network | https://string-db.org/network/866895.HBHAL_2897 | Dihydroorotase; Catalyzes the reversible cyclization of carbamoyl aspartate to dihydroorotate; Belongs to the metallo-dependent hydrolases superfamily. DHOase family. Class I DHOase subfamily. |
| carA1 protein network | https://string-db.org/network/866895.HBHAL_2898 | Carbamoyl phosphate synthase small subunit; Belongs to the CarA family. |
| carB1 protein network | https://string-db.org/network/866895.HBHAL_2899 | Carbamoyl phosphate synthase large subunit; Belongs to the CarB family. |
| pyrK protein network | https://string-db.org/network/866895.HBHAL_2900 | Dihydroorotate dehydrogenase (NAD+) electron transfer subunit; Responsible for channeling the electrons from the oxidation of dihydroorotate from the FMN redox center in the PyrD type B subunit t [...] |
| pyrD protein network | https://string-db.org/network/866895.HBHAL_2901 | Dihydroorotate dehydrogenase (NAD+) catalytic subunit; Catalyzes the conversion of dihydroorotate to orotate. |
| pyrF protein network | https://string-db.org/network/866895.HBHAL_2902 | Orotidine 5'-phosphate decarboxylase; Catalyzes the decarboxylation of orotidine 5'-monophosphate (OMP) to uridine 5'-monophosphate (UMP); Belongs to the OMP decarboxylase family. Type 1 subfamil [...] |
| pyrE protein network | https://string-db.org/network/866895.HBHAL_2903 | Orotate phosphoribosyltransferase; Catalyzes the transfer of a ribosyl phosphate group from 5- phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP). |
| CCG45252.1 protein network | https://string-db.org/network/866895.HBHAL_2904 | Hypothetical protein. |
| CCG45253.1 protein network | https://string-db.org/network/866895.HBHAL_2905 | Fibronectin/fibrinogen-binding protein, putative. |
| CCG45254.1 protein network | https://string-db.org/network/866895.HBHAL_2906 | Hypothetical protein. |
| CCG45255.1 protein network | https://string-db.org/network/866895.HBHAL_2907 | Conserved hypothetical protein; Belongs to the RemA family. |
| gmk protein network | https://string-db.org/network/866895.HBHAL_2908 | Guanylate kinase; Essential for recycling GMP and indirectly, cGMP. |
| rpoZ protein network | https://string-db.org/network/866895.HBHAL_2909 | DNA-directed RNA polymerase omega subunit; Promotes RNA polymerase assembly. Latches the N- and C- terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alp [...] |
| CCG45258.1 protein network | https://string-db.org/network/866895.HBHAL_2910 | Pantothenate metabolism; Catalyzes two steps in the biosynthesis of coenzyme A. In the first step cysteine is conjugated to 4'-phosphopantothenate to form 4- phosphopantothenoylcysteine, in the l [...] |
| priA protein network | https://string-db.org/network/866895.HBHAL_2911 | Primosome assembly protein PriA; Involved in the restart of stalled replication forks. Recognizes and binds the arrested nascent DNA chain at stalled replication forks. It can open the DNA duplex [...] |
| fmt protein network | https://string-db.org/network/866895.HBHAL_2912 | methionyl-tRNA formyltransferase; Attaches a formyl group to the free amino group of methionyl- tRNA(fMet). The formyl group appears to play a dual role in the initiator identity of N-formylmethi [...] |
| CCG45261.1 protein network | https://string-db.org/network/866895.HBHAL_2913 | Sun protein; Specifically methylates the cytosine at position 967 (m5C967) of 16S rRNA. |
| prpC protein network | https://string-db.org/network/866895.HBHAL_2914 | Protein phosphatase 2C. |
| prkC protein network | https://string-db.org/network/866895.HBHAL_2915 | Serine/threonine protein kinase PrkC. |
| rsgA protein network | https://string-db.org/network/866895.HBHAL_2916 | Ribosome-associated GTPase; One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play [...] |
| rpe protein network | https://string-db.org/network/866895.HBHAL_2917 | Ribulose-phosphate 3-epimerase; Belongs to the ribulose-phosphate 3-epimerase family. |
| thiN protein network | https://string-db.org/network/866895.HBHAL_2918 | Thiamine pyrophosphokinase. |
| rpmB protein network | https://string-db.org/network/866895.HBHAL_2919 | 50S ribosomal protein L28; Belongs to the bacterial ribosomal protein bL28 family. |
| CCG45268.1 protein network | https://string-db.org/network/866895.HBHAL_2920 | Conserved hypothetical protein. |
| CCG45269.1 protein network | https://string-db.org/network/866895.HBHAL_2921 | Conserved hypothetical protein. |
| rsbR4 protein network | https://string-db.org/network/866895.HBHAL_2922 | RsbR family protein. |
| CCG45271.1 protein network | https://string-db.org/network/866895.HBHAL_2923 | MFS-type transporter; Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. |
| CCG45272.1 protein network | https://string-db.org/network/866895.HBHAL_2924 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| CCG45273.1 protein network | https://string-db.org/network/866895.HBHAL_2925 | Hypothetical protein. |
| CCG45274.1 protein network | https://string-db.org/network/866895.HBHAL_2926 | Heat shock protein Hsp20; Belongs to the small heat shock protein (HSP20) family. |
| yozB protein network | https://string-db.org/network/866895.HBHAL_2927 | Conserved hypothetical protein. |
| CCG45276.1 protein network | https://string-db.org/network/866895.HBHAL_2928 | Hypothetical protein. |
| uvsE2 protein network | https://string-db.org/network/866895.HBHAL_2929 | UV damage endonuclease. |
| rlmN protein network | https://string-db.org/network/866895.HBHAL_2930 | 23S rRNA (adenine-C2)-methyltransferase RlmN; Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs; Belongs to the radical SAM superfamily. RlmN fa [...] |
| CCG45279.1 protein network | https://string-db.org/network/866895.HBHAL_2931 | Hypothetical protein. |
| uspA4 protein network | https://string-db.org/network/866895.HBHAL_2932 | UspA domain protein. |
| CCG45281.1 protein network | https://string-db.org/network/866895.HBHAL_2933 | LacI family transcription regulator. |
| CCG45282.1 protein network | https://string-db.org/network/866895.HBHAL_2934 | ABC-type transport system extracellular binding protein (probable substrate sugar). |
| yvgZ protein network | https://string-db.org/network/866895.HBHAL_2935 | Hypothetical protein. |
| CCG45284.1 protein network | https://string-db.org/network/866895.HBHAL_2936 | Heavy metal-transporting P-type ATPase. |
| CCG45285.1 protein network | https://string-db.org/network/866895.HBHAL_2937 | Hypothetical protein. |
| copB protein network | https://string-db.org/network/866895.HBHAL_2938 | Heavy metal translocating P-type ATPase. |
| CCG45287.1 protein network | https://string-db.org/network/866895.HBHAL_2939 | Hypothetical protein. |
| pphA protein network | https://string-db.org/network/866895.HBHAL_2940 | Serine/threonine protein phosphatase. |
| guaC protein network | https://string-db.org/network/866895.HBHAL_2941 | GMP reductase; Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and [...] |
| CCG45290.1 protein network | https://string-db.org/network/866895.HBHAL_2942 | Diguanylate phosphodiesterase domain protein. |
| CCG45291.1 protein network | https://string-db.org/network/866895.HBHAL_2943 | NADH:flavin oxidoreductase. |
| CCG45292.1 protein network | https://string-db.org/network/866895.HBHAL_2944 | Ferredoxin; Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
| CCG45293.1 protein network | https://string-db.org/network/866895.HBHAL_2945 | Pirin-like protein; Belongs to the pirin family. |
| CCG45294.1 protein network | https://string-db.org/network/866895.HBHAL_2946 | MarR family transcription regulator. |
| CCG45295.1 protein network | https://string-db.org/network/866895.HBHAL_2947 | Hypothetical protein. |
| CCG45296.1 protein network | https://string-db.org/network/866895.HBHAL_2948 | SSS family transporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| CCG45298.1 protein network | https://string-db.org/network/866895.HBHAL_2950 | ABC-type transport system extracellular binding protein (probable substrate iron complex). |
| CCG45299.1 protein network | https://string-db.org/network/866895.HBHAL_2951 | ABC-type transport system permease protein (probable substrate iron complex); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily. |
| CCG45300.1 protein network | https://string-db.org/network/866895.HBHAL_2952 | ABC-type transport system permease protein (probable substrate iron complex); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily. |
| CCG45301.1 protein network | https://string-db.org/network/866895.HBHAL_2953 | Hypothetical protein. |
| CCG45302.1 protein network | https://string-db.org/network/866895.HBHAL_2954 | Hypothetical protein. |
| CCG45303.1 protein network | https://string-db.org/network/866895.HBHAL_2955 | Conserved hypothetical protein. |
| rsbR2 protein network | https://string-db.org/network/866895.HBHAL_2956 | RsbR family protein. |
| yuaG protein network | https://string-db.org/network/866895.HBHAL_2957 | Conserved hypothetical protein. |
| CCG45306.1 protein network | https://string-db.org/network/866895.HBHAL_2958 | Hypothetical protein. |
| CCG45307.1 protein network | https://string-db.org/network/866895.HBHAL_2959 | Conserved hypothetical protein. |
| CCG45308.1 protein network | https://string-db.org/network/866895.HBHAL_2960 | Hypothetical protein. |
| pulA protein network | https://string-db.org/network/866895.HBHAL_2962 | Pullulanase; Belongs to the glycosyl hydrolase 13 family. |
| CCG45311.1 protein network | https://string-db.org/network/866895.HBHAL_2963 | LacI family transcription regulator. |
| sspH-2 protein network | https://string-db.org/network/866895.HBHAL_2964 | Acid-soluble spore protein; Belongs to the SspH family. |
| CCG45313.1 protein network | https://string-db.org/network/866895.HBHAL_2965 | Hypothetical protein. |
| CCG45315.1 protein network | https://string-db.org/network/866895.HBHAL_2967 | Hypothetical protein. |
| CCG45316.1 protein network | https://string-db.org/network/866895.HBHAL_2968 | Hypothetical protein. |
| CCG45317.1 protein network | https://string-db.org/network/866895.HBHAL_2969 | ISL3-type transposase. |
| pflA protein network | https://string-db.org/network/866895.HBHAL_2970 | Pyruvate formate-lyase-activating enzyme; Activation of pyruvate formate-lyase under anaerobic conditions by generation of an organic free radical, using S- adenosylmethionine and reduced flavodo [...] |
| CCG45319.1 protein network | https://string-db.org/network/866895.HBHAL_2971 | Alcohol dehydrogenase. |
| CCG45320.1 protein network | https://string-db.org/network/866895.HBHAL_2972 | Formate acetyltransferase. |
| CCG45321.1 protein network | https://string-db.org/network/866895.HBHAL_2974 | Hypothetical protein. |
| CCG45322.1 protein network | https://string-db.org/network/866895.HBHAL_2975 | Short-chain dehydrogenase/reductase family protein. |
| CCG45323.1 protein network | https://string-db.org/network/866895.HBHAL_2976 | Hypothetical protein. |
| CCG45324.1 protein network | https://string-db.org/network/866895.HBHAL_2977 | Conserved hypothetical protein. |
| CCG45325.1 protein network | https://string-db.org/network/866895.HBHAL_2978 | Hypothetical protein. |
| CCG45326.1 protein network | https://string-db.org/network/866895.HBHAL_2979 | Hypothetical protein. |
| CCG45327.1 protein network | https://string-db.org/network/866895.HBHAL_2980 | TetR family transcription regulator. |
| CCG45328.1 protein network | https://string-db.org/network/866895.HBHAL_2981 | Putative MFS-type transporter; Belongs to the major facilitator superfamily. |
| CCG45329.1 protein network | https://string-db.org/network/866895.HBHAL_2982 | acyl-CoA carboxylase alpha subunit. |
| CCG45330.1 protein network | https://string-db.org/network/866895.HBHAL_2983 | long-chain-fatty-acid--CoA ligase. |
| CCG45331.1 protein network | https://string-db.org/network/866895.HBHAL_2984 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| CCG45332.1 protein network | https://string-db.org/network/866895.HBHAL_2985 | SET domain protein. |
| CCG45333.1 protein network | https://string-db.org/network/866895.HBHAL_2986 | Hypothetical protein. |
| CCG45335.1 protein network | https://string-db.org/network/866895.HBHAL_2988 | Hypothetical protein. |
| CCG45336.1 protein network | https://string-db.org/network/866895.HBHAL_2989 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| CCG45337.1 protein network | https://string-db.org/network/866895.HBHAL_2990 | Putative carboxymuconolactone decarboxylase. |
| murE-3 protein network | https://string-db.org/network/866895.HBHAL_2992 | UDP-N-acetylmuramyl-tripeptide synthetase; Catalyzes the addition of an amino acid to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanyl-D-glutamate (UMAG) in the biosynthesis of bacterial ce [...] |
| cpdB protein network | https://string-db.org/network/866895.HBHAL_2993 | 2',3'-cyclic nucleotide 2'-phosphodiesterase. |
| CCG45341.1 protein network | https://string-db.org/network/866895.HBHAL_2994 | MFS-type transporter (probable function xanthine/uracil permease). |
| CCG45342.1 protein network | https://string-db.org/network/866895.HBHAL_2995 | L-serine dehydratase beta subunit; Belongs to the iron-sulfur dependent L-serine dehydratase family. |
| CCG45343.1 protein network | https://string-db.org/network/866895.HBHAL_2996 | L-serine dehydratase alpha subunit; Belongs to the iron-sulfur dependent L-serine dehydratase family. |
| recG protein network | https://string-db.org/network/866895.HBHAL_2997 | ATP-dependent DNA helicase RecG; Critical role in recombination and DNA repair. Helps process Holliday junction intermediates to mature products by catalyzing branch migration. Has a DNA unwindin [...] |
| ykfA protein network | https://string-db.org/network/866895.HBHAL_2998 | S66 family peptidase. |
| fapR protein network | https://string-db.org/network/866895.HBHAL_2999 | Transcription regulator FapR; Transcriptional factor involved in regulation of membrane lipid biosynthesis by repressing genes involved in fatty acid and phospholipid metabolism. |
| plsX protein network | https://string-db.org/network/866895.HBHAL_3000 | Fatty acid/phospholipid synthesis protein; Catalyzes the reversible formation of acyl-phosphate (acyl- PO(4)) from acyl-[acyl-carrier-protein] (acyl-ACP). This enzyme utilizes acyl-ACP as fatty a [...] |
| fabD protein network | https://string-db.org/network/866895.HBHAL_3001 | Acyl-carrier-protein S-malonyltransferase. |
| CCG45349.1 protein network | https://string-db.org/network/866895.HBHAL_3002 | 3-oxoacyl-[acyl-carrier-protein] reductase; Catalyzes the NADPH-dependent reduction of beta-ketoacyl-ACP substrates to beta-hydroxyacyl-ACP products, the first reductive step in the elongation cy [...] |
| acpP protein network | https://string-db.org/network/866895.HBHAL_3003 | Acyl carrier protein; Carrier of the growing fatty acid chain in fatty acid biosynthesis. |
| rnc protein network | https://string-db.org/network/866895.HBHAL_3004 | Ribonuclease III; Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some m [...] |
| CCG45352.1 protein network | https://string-db.org/network/866895.HBHAL_3005 | Hypothetical protein. |
| smc protein network | https://string-db.org/network/866895.HBHAL_3006 | Chromosome partition protein Smc; Required for chromosome condensation and partitioning. Belongs to the SMC family. |
| ftsY protein network | https://string-db.org/network/866895.HBHAL_3007 | Signal recognition particle-docking protein FtsY; Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Acts as a receptor for the complex formed by the [...] |
| CCG45355.1 protein network | https://string-db.org/network/866895.HBHAL_3008 | UPF0122 family protein; Might take part in the signal recognition particle (SRP) pathway. This is inferred from the conservation of its genetic proximity to ftsY/ffh. May be a regulatory protein. |
| ffh protein network | https://string-db.org/network/866895.HBHAL_3009 | Signal recognition particle protein; Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-nasce [...] |
| rpsP protein network | https://string-db.org/network/866895.HBHAL_3010 | 30S ribosomal protein S16; Belongs to the bacterial ribosomal protein bS16 family. |
| ylqC protein network | https://string-db.org/network/866895.HBHAL_3011 | UPF0109 family protein; Belongs to the UPF0109 family. |
| ylqD protein network | https://string-db.org/network/866895.HBHAL_3012 | Hypothetical protein. |
| rimM protein network | https://string-db.org/network/866895.HBHAL_3013 | 16S rRNA processing protein RimM; An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19 [...] |
| trmD protein network | https://string-db.org/network/866895.HBHAL_3014 | tRNA (guanine-N(1)-)-methyltransferase; Specifically methylates guanosine-37 in various tRNAs. Belongs to the RNA methyltransferase TrmD family. |
| rplS protein network | https://string-db.org/network/866895.HBHAL_3015 | 50S ribosomal protein L19; This protein is located at the 30S-50S ribosomal subunit interface and may play a role in the structure and function of the aminoacyl-tRNA binding site. |
| sipT2 protein network | https://string-db.org/network/866895.HBHAL_3016 | Signal peptidase I; Belongs to the peptidase S26 family. |
| ylqF protein network | https://string-db.org/network/866895.HBHAL_3017 | Ribosomal biogenesis GTPase; Required for a late step of 50S ribosomal subunit assembly. Has GTPase activity; Belongs to the TRAFAC class YlqF/YawG GTPase family. MTG1 subfamily. |
| rnhB protein network | https://string-db.org/network/866895.HBHAL_3018 | Ribonuclease HII; Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. |
| ylqG protein network | https://string-db.org/network/866895.HBHAL_3019 | Hypothetical protein. |
| ylqH protein network | https://string-db.org/network/866895.HBHAL_3020 | Flagellar biosynthesis protein. |
| sucC protein network | https://string-db.org/network/866895.HBHAL_3021 | succinyl-CoA synthetase beta subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus repr [...] |
| sucD protein network | https://string-db.org/network/866895.HBHAL_3022 | succinyl-CoA synthetase alpha subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus rep [...] |
| smf protein network | https://string-db.org/network/866895.HBHAL_3023 | Smf family DNA processing protein. |
| topA protein network | https://string-db.org/network/866895.HBHAL_3024 | DNA topoisomerase I; Releases the supercoiling and torsional tension of DNA, which is introduced during the DNA replication and transcription, by transiently cleaving and rejoining one strand of [...] |
| xerC protein network | https://string-db.org/network/866895.HBHAL_3025 | Site-specific tyrosine recombinase XerC; Site-specific tyrosine recombinase, which acts by catalyzing the cutting and rejoining of the recombining DNA molecules. The XerC- XerD complex is essenti [...] |
| clpQ protein network | https://string-db.org/network/866895.HBHAL_3026 | ATP-dependent protease peptidase subunit; Protease subunit of a proteasome-like degradation complex believed to be a general protein degrading machinery. |
| hslU protein network | https://string-db.org/network/866895.HBHAL_3027 | ATP-dependent protease ATP-binding subunit; ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU [...] |
| codY protein network | https://string-db.org/network/866895.HBHAL_3028 | GTP-sensing pleiotropic transcription repressor CodY; DNA-binding protein that represses the expression of many genes that are induced as cells make the transition from rapid exponential growth t [...] |
| flgB protein network | https://string-db.org/network/866895.HBHAL_3029 | Flagellar basal body rod protein; Structural component of flagellum, the bacterial motility apparatus. Part of the rod structure of flagellar basal body. |
| flgC protein network | https://string-db.org/network/866895.HBHAL_3030 | Flagellar basal body rod protein; Belongs to the flagella basal body rod proteins family. |
| fliE protein network | https://string-db.org/network/866895.HBHAL_3031 | Flagellar hook-basal body protein. |
| fliF protein network | https://string-db.org/network/866895.HBHAL_3032 | Flagellar MS-ring protein; The M ring may be actively involved in energy transduction. Belongs to the FliF family. |
| fliG protein network | https://string-db.org/network/866895.HBHAL_3033 | Flagellar motor switch protein. |
| fliH protein network | https://string-db.org/network/866895.HBHAL_3034 | Flagellar assembly protein. |
| fliI protein network | https://string-db.org/network/866895.HBHAL_3035 | Flagellar export ATPase. |
| fliJ protein network | https://string-db.org/network/866895.HBHAL_3036 | Flagellar biosynthesis chaperone. |
| CCG45384.1 protein network | https://string-db.org/network/866895.HBHAL_3037 | Hypothetical protein. |
| CCG45385.1 protein network | https://string-db.org/network/866895.HBHAL_3038 | Homolog to flagellar hook-length control protein. |
| flgD protein network | https://string-db.org/network/866895.HBHAL_3039 | Flagellar hook assembly protein. |
| CCG45387.1 protein network | https://string-db.org/network/866895.HBHAL_3040 | Conserved hypothetical protein. |
| flgG protein network | https://string-db.org/network/866895.HBHAL_3041 | Flagellar hook-basal body protein. |
| CCG45389.1 protein network | https://string-db.org/network/866895.HBHAL_3042 | Hypothetical protein. |
| fliL protein network | https://string-db.org/network/866895.HBHAL_3043 | Flagellar protein FliL. |
| fliM protein network | https://string-db.org/network/866895.HBHAL_3044 | Flagellar motor switch protein. |
| fliY protein network | https://string-db.org/network/866895.HBHAL_3045 | Flagellar motor switch protein. |
| cheY protein network | https://string-db.org/network/866895.HBHAL_3046 | Chemotaxis protein CheY. |
| fliZ protein network | https://string-db.org/network/866895.HBHAL_3047 | Flagellar biosynthetic protein FliZ. |
| fliP protein network | https://string-db.org/network/866895.HBHAL_3048 | Flagellar biosynthesis protein; Plays a role in the flagellum-specific transport system. Belongs to the FliP/MopC/SpaP family. |
| fliQ protein network | https://string-db.org/network/866895.HBHAL_3049 | Flagellar biosynthesis protein; Role in flagellar biosynthesis. Belongs to the FliQ/MopD/SpaQ family. |
| fliR protein network | https://string-db.org/network/866895.HBHAL_3050 | Flagellar biosynthesis protein; Role in flagellar biosynthesis. Belongs to the FliR/MopE/SpaR family. |
| flhB protein network | https://string-db.org/network/866895.HBHAL_3051 | Flagellar biosynthesis protein; Required for formation of the rod structure in the basal body of the flagellar apparatus. Together with FliI and FliH, may constitute the export apparatus of flage [...] |
| flhA protein network | https://string-db.org/network/866895.HBHAL_3052 | Flagellar biosynthesis protein; Required for formation of the rod structure of the flagellar apparatus. Together with FliI and FliH, may constitute the export apparatus of flagellin; Belongs to t [...] |
| flhF protein network | https://string-db.org/network/866895.HBHAL_3053 | Flagellar biosynthesis regulator. |
| flhG protein network | https://string-db.org/network/866895.HBHAL_3054 | Flagellar biosynthesis protein. |
| CCG45402.1 protein network | https://string-db.org/network/866895.HBHAL_3055 | Hypothetical protein. |
| cheA protein network | https://string-db.org/network/866895.HBHAL_3056 | Chemotaxis protein CheA. |
| cheW protein network | https://string-db.org/network/866895.HBHAL_3057 | Chemotaxis protein CheW. |
| CCG45405.1 protein network | https://string-db.org/network/866895.HBHAL_3058 | Chemotactic methyltransferase inhibitor. |
| cheD protein network | https://string-db.org/network/866895.HBHAL_3059 | Chemoreceptor glutamine deamidase; Probably deamidates glutamine residues to glutamate on methyl-accepting chemotaxis receptors (MCPs), playing an important role in chemotaxis; Belongs to the Che [...] |
| sigD protein network | https://string-db.org/network/866895.HBHAL_3060 | RNA polymerase sigma factor SigD; Belongs to the sigma-70 factor family. |
| CCG45408.1 protein network | https://string-db.org/network/866895.HBHAL_3061 | Hypothetical protein. |
| CCG45409.1 protein network | https://string-db.org/network/866895.HBHAL_3062 | Hypothetical protein. |
| ylxL protein network | https://string-db.org/network/866895.HBHAL_3063 | Hypothetical protein. |
| rpsB protein network | https://string-db.org/network/866895.HBHAL_3064 | 30S ribosomal protein S2; Belongs to the universal ribosomal protein uS2 family. |
| tsf protein network | https://string-db.org/network/866895.HBHAL_3065 | Translation elongation factor Ts; Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF- Tu.GTP complex up to the GTP hydrolysis [...] |
| pyrH1 protein network | https://string-db.org/network/866895.HBHAL_3066 | Uridylate kinase; Catalyzes the reversible phosphorylation of UMP to UDP. |
| frr protein network | https://string-db.org/network/866895.HBHAL_3067 | Ribosome recycling factor; Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosome [...] |
| uppS protein network | https://string-db.org/network/866895.HBHAL_3068 | Undecaprenyl pyrophosphate synthase; Catalyzes the condensation of isopentenyl diphosphate (IPP) with allylic pyrophosphates generating different type of terpenoids. |
| cdsA protein network | https://string-db.org/network/866895.HBHAL_3069 | Phosphatidate cytidylyltransferase; Belongs to the CDS family. |
| dxr protein network | https://string-db.org/network/866895.HBHAL_3070 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Catalyzes the NADP-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4- phosphate (MEP); Be [...] |
| CCG45418.1 protein network | https://string-db.org/network/866895.HBHAL_3071 | Putative membrane-associated zinc metalloprotease. |
| proS protein network | https://string-db.org/network/866895.HBHAL_3072 | prolyl-tRNA synthetase; Catalyzes the attachment of proline to tRNA(Pro) in a two- step reaction: proline is first activated by ATP to form Pro-AMP and then transferred to the acceptor end of tRN [...] |
| polC protein network | https://string-db.org/network/866895.HBHAL_3073 | DNA polymerase III (gram-positive type); Required for replicative DNA synthesis. This DNA polymerase also exhibits 3' to 5' exonuclease activity. |
| ylxS protein network | https://string-db.org/network/866895.HBHAL_3074 | Conserved hypothetical protein; Required for maturation of 30S ribosomal subunits. Belongs to the RimP family. |
| nusA protein network | https://string-db.org/network/866895.HBHAL_3075 | Transcription elongation factor NusA; Participates in both transcription termination and antitermination. |
| CCG45423.1 protein network | https://string-db.org/network/866895.HBHAL_3076 | Conserved hypothetical protein. |
| ylxQ protein network | https://string-db.org/network/866895.HBHAL_3077 | Hypothetical protein. |
| infB protein network | https://string-db.org/network/866895.HBHAL_3078 | Translation initiation factor IF-2; One of the essential components for the initiation of protein synthesis. Protects formylmethionyl-tRNA from spontaneous hydrolysis and promotes its binding to [...] |
| ylxP protein network | https://string-db.org/network/866895.HBHAL_3079 | Hypothetical protein. |
| rbfA protein network | https://string-db.org/network/866895.HBHAL_3080 | Ribosome-binding factor A; One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but n [...] |
| truB protein network | https://string-db.org/network/866895.HBHAL_3081 | tRNA pseudouridine 55 synthase; Responsible for synthesis of pseudouridine from uracil-55 in the psi GC loop of transfer RNAs; Belongs to the pseudouridine synthase TruB family. Type 1 subfamily. |
| CCG45429.1 protein network | https://string-db.org/network/866895.HBHAL_3082 | Riboflavin biosynthesis protein; Belongs to the ribF family. |
| rpsO protein network | https://string-db.org/network/866895.HBHAL_3083 | 30S ribosomal protein S15; Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome. |
| pnpA protein network | https://string-db.org/network/866895.HBHAL_3084 | Polyribonucleotide nucleotidyltransferase; Involved in mRNA degradation. Catalyzes the phosphorolysis of single-stranded polyribonucleotides processively in the 3'- to 5'- direction. |
| CCG45432.1 protein network | https://string-db.org/network/866895.HBHAL_3085 | Probable sporulation protein, polysaccharide deacetylase family. |
| CCG45433.1 protein network | https://string-db.org/network/866895.HBHAL_3086 | Conserved hypothetical protein. |
| spoVFA protein network | https://string-db.org/network/866895.HBHAL_3087 | Dipicolinate synthase subunit A. |
| CCG45435.1 protein network | https://string-db.org/network/866895.HBHAL_3088 | Dipicolinate synthase subunit B. |
| asd protein network | https://string-db.org/network/866895.HBHAL_3089 | Aspartate-semialdehyde dehydrogenase; Catalyzes the NADPH-dependent formation of L-aspartate- semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl- 4-phosphate; Belongs to the as [...] |
| dapG1 protein network | https://string-db.org/network/866895.HBHAL_3090 | Aspartate kinase; Belongs to the aspartokinase family. |
| dapA2 protein network | https://string-db.org/network/866895.HBHAL_3091 | Dihydrodipicolinate synthase; Catalyzes the condensation of (S)-aspartate-beta-semialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA). |
| tepA protein network | https://string-db.org/network/866895.HBHAL_3093 | Hypothetical protein. |
| CCG45441.1 protein network | https://string-db.org/network/866895.HBHAL_3094 | Hypothetical protein. |
| ftsK protein network | https://string-db.org/network/866895.HBHAL_3095 | DNA translocase FtsK; Belongs to the FtsK/SpoIIIE/SftA family. |
| CCG45443.1 protein network | https://string-db.org/network/866895.HBHAL_3096 | GntR family transcription regulator. |
| yufN protein network | https://string-db.org/network/866895.HBHAL_3097 | Bmp domain protein. |
| CCG45445.1 protein network | https://string-db.org/network/866895.HBHAL_3098 | ABC-type transport system ATP-binding protein (probable substrate sugar). |
| CCG45446.1 protein network | https://string-db.org/network/866895.HBHAL_3099 | ABC-type transport system permease protein (probable substrate sugar); Belongs to the binding-protein-dependent transport system permease family. |
| CCG45447.1 protein network | https://string-db.org/network/866895.HBHAL_3100 | ABC-type transport system permease protein (probable substrate sugar); Belongs to the binding-protein-dependent transport system permease family. |
| CCG45448.1 protein network | https://string-db.org/network/866895.HBHAL_3101 | M16 family peptidase. |
| CCG45449.1 protein network | https://string-db.org/network/866895.HBHAL_3102 | Zinc protease, insulinase family. |
| CCG45450.1 protein network | https://string-db.org/network/866895.HBHAL_3103 | Short-chain dehydrogenase/reductase family protein. |
| ymfJ protein network | https://string-db.org/network/866895.HBHAL_3104 | Hypothetical protein. |
| CCG45452.1 protein network | https://string-db.org/network/866895.HBHAL_3105 | Conserved hypothetical protein. |
| ymfM protein network | https://string-db.org/network/866895.HBHAL_3106 | Hypothetical protein. |
| pgsA protein network | https://string-db.org/network/866895.HBHAL_3108 | CDP-diacylglycerol--glycerol-3-phosphate3- phosphatidyltransferase; Belongs to the CDP-alcohol phosphatidyltransferase class-I family. |
| cinA protein network | https://string-db.org/network/866895.HBHAL_3109 | Putative competence damage-inducible protein; Belongs to the CinA family. |
| recA protein network | https://string-db.org/network/866895.HBHAL_3110 | Recombination protein RecA; Can catalyze the hydrolysis of ATP in the presence of single- stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybrid [...] |
| rny protein network | https://string-db.org/network/866895.HBHAL_3111 | Ribonuclease Y; Endoribonuclease that initiates mRNA decay. |
| CCG45459.1 protein network | https://string-db.org/network/866895.HBHAL_3112 | Conserved hypothetical protein. |
| CCG45460.1 protein network | https://string-db.org/network/866895.HBHAL_3113 | Stage V sporulation protein S. |
| tdh protein network | https://string-db.org/network/866895.HBHAL_3114 | L-threonine 3-dehydrogenase; Catalyzes the NAD(+)-dependent oxidation of L-threonine to 2- amino-3-ketobutyrate; Belongs to the zinc-containing alcohol dehydrogenase family. |
| CCG45462.1 protein network | https://string-db.org/network/866895.HBHAL_3115 | Pyridoxal phosphate-dependent acyltransferase; Catalyzes the decarboxylative condensation of pimeloyl-[acyl- carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier [...] |
| miaB protein network | https://string-db.org/network/866895.HBHAL_3116 | tRNA-i(6)A37 thiotransferase enzyme MiaB; Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6- (dimethylallyl)adenosine (ms(2)i(6)A) [...] |
| ymcA protein network | https://string-db.org/network/866895.HBHAL_3117 | Hypothetical protein; Belongs to the UPF0342 family. |
| CCG45465.1 protein network | https://string-db.org/network/866895.HBHAL_3118 | Spore coat protein. |
| mutS1 protein network | https://string-db.org/network/866895.HBHAL_3119 | DNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. It is possible that it carries out the mismatch recognition step. This protein has a weak ATPase act [...] |
| mutL protein network | https://string-db.org/network/866895.HBHAL_3120 | DNA mismatch repair protein MutL; This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a 'molecular matchm [...] |
| CCG45468.1 protein network | https://string-db.org/network/866895.HBHAL_3121 | SinR/xre family transcription regulator. |
| miaA protein network | https://string-db.org/network/866895.HBHAL_3122 | tRNA dimethylallyltransferase; Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(di [...] |
| hfq protein network | https://string-db.org/network/866895.HBHAL_3123 | RNA-binding protein Hfq; RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and chang [...] |
| CCG45471.1 protein network | https://string-db.org/network/866895.HBHAL_3124 | Stage V sporulation protein K. |
| hflX protein network | https://string-db.org/network/866895.HBHAL_3125 | GTPase HflX; GTPase that associates with the 50S ribosomal subunit and may have a role during protein synthesis or ribosome biogenesis. Belongs to the TRAFAC class OBG-HflX-like GTPase superfamil [...] |
| ynbB protein network | https://string-db.org/network/866895.HBHAL_3126 | Hypothetical protein. |
| glnR protein network | https://string-db.org/network/866895.HBHAL_3127 | Transcription regulator GlnR. |
| glnA1 protein network | https://string-db.org/network/866895.HBHAL_3128 | Glutamine synthetase. |
| CCG45478.1 protein network | https://string-db.org/network/866895.HBHAL_3131 | ISL3-type transposase. |
| lexA protein network | https://string-db.org/network/866895.HBHAL_3132 | LexA repressor; Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. In the presence of single-stranded DNA, RecA interacts with LexA causin [...] |
| CCG45480.1 protein network | https://string-db.org/network/866895.HBHAL_3133 | Hypothetical protein. |
| CCG45481.1 protein network | https://string-db.org/network/866895.HBHAL_3134 | Site-specific recombinase, resolvase family. |
| ynzC protein network | https://string-db.org/network/866895.HBHAL_3135 | UPF0291 protein. |
| tkt protein network | https://string-db.org/network/866895.HBHAL_3136 | Transketolase; Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate. |
| yneF protein network | https://string-db.org/network/866895.HBHAL_3137 | Conserved hypothetical protein. |
| ccdA2 protein network | https://string-db.org/network/866895.HBHAL_3138 | Cytochrome c-type biogenesis protein CcdA. |
| CCG45486.1 protein network | https://string-db.org/network/866895.HBHAL_3139 | Multicomponent Na+/H+ antiporter familiy protein subunit B. |
| ccdC protein network | https://string-db.org/network/866895.HBHAL_3142 | Locus_tag: HBHAL_3140; product: probable two-component response regulator (nonfunctional); gene has an in-frame stop codon; conceptual translation after in silico reconstruction: MARILVVDDAKFTRLT [...] |
| CCG45489.1 protein network | https://string-db.org/network/866895.HBHAL_3143 | Hypothetical protein. |
| acnA protein network | https://string-db.org/network/866895.HBHAL_3144 | Aconitate hydratase; Catalyzes the isomerization of citrate to isocitrate via cis- aconitate. |
| CCG45491.1 protein network | https://string-db.org/network/866895.HBHAL_3145 | AhpC/TSA family protein. |
| CCG45492.1 protein network | https://string-db.org/network/866895.HBHAL_3146 | Hypothetical protein. |
| CCG45493.1 protein network | https://string-db.org/network/866895.HBHAL_3147 | IS1341-type transposase. |
| tlp protein network | https://string-db.org/network/866895.HBHAL_3149 | Small acid-soluble spore protein; Belongs to the Tlp family. |
| CCG45495.1 protein network | https://string-db.org/network/866895.HBHAL_3150 | Stage V sporulation protein K. |
| yneP protein network | https://string-db.org/network/866895.HBHAL_3151 | Conserved hypothetical protein. |
| yneQ protein network | https://string-db.org/network/866895.HBHAL_3152 | Hypothetical protein. |
| yneR protein network | https://string-db.org/network/866895.HBHAL_3153 | Hypothetical protein. |
| CCG45499.1 protein network | https://string-db.org/network/866895.HBHAL_3154 | Conserved hypothetical protein; Could be involved in insertion of integral membrane proteins into the membrane; Belongs to the UPF0161 family. |
| yciA protein network | https://string-db.org/network/866895.HBHAL_3155 | Conserved hypothetical protein; Converts GTP to 7,8-dihydroneopterin triphosphate. |
| yneS protein network | https://string-db.org/network/866895.HBHAL_3156 | Hypothetical protein; Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phospha [...] |
| opuBA protein network | https://string-db.org/network/866895.HBHAL_3157 | ABC-type transport system ATP-binding protein (probable substrate osmoprotectant). |
| opuBBC protein network | https://string-db.org/network/866895.HBHAL_3158 | ABC-type transport system permease/substrate-binding protein (probable substrate osmoprotectant). |
| CCG45504.1 protein network | https://string-db.org/network/866895.HBHAL_3159 | CoA binding domain family protein. |
| parE protein network | https://string-db.org/network/866895.HBHAL_3160 | DNA topoisomerase IV subunit B; Topoisomerase IV is essential for chromosome segregation. It relaxes supercoiled DNA. Performs the decatenation events required during the replication of a circula [...] |
| parC protein network | https://string-db.org/network/866895.HBHAL_3161 | DNA topoisomerase IV subunit A; Topoisomerase IV is essential for chromosome segregation. It relaxes supercoiled DNA. Performs the decatenation events required during the replication of a circula [...] |
| CCG45507.1 protein network | https://string-db.org/network/866895.HBHAL_3162 | TetR family transcription regulator. |
| CCG45508.1 protein network | https://string-db.org/network/866895.HBHAL_3163 | acyl-CoA dehydrogenase. |
| CCG45509.1 protein network | https://string-db.org/network/866895.HBHAL_3164 | long-chain-fatty-acid--CoA ligase. |
| yngH protein network | https://string-db.org/network/866895.HBHAL_3165 | Biotin carboxylase. |
| CCG45511.1 protein network | https://string-db.org/network/866895.HBHAL_3166 | Biotin/lipoyl attachment domain protein. |
| yngG protein network | https://string-db.org/network/866895.HBHAL_3167 | hydroxymethylglutaryl-CoA lyase. |
| CCG45513.1 protein network | https://string-db.org/network/866895.HBHAL_3168 | enoyl-CoA hydratase; Belongs to the enoyl-CoA hydratase/isomerase family. |
| CCG45514.1 protein network | https://string-db.org/network/866895.HBHAL_3169 | propionyl-CoA carboxylase. |
| acs protein network | https://string-db.org/network/866895.HBHAL_3170 | acetoacetyl-CoA synthase, putative. |
| sqdB protein network | https://string-db.org/network/866895.HBHAL_3171 | Sulfolipid biosynthesis protein. |
| CCG45517.1 protein network | https://string-db.org/network/866895.HBHAL_3172 | Group 1 glycosyltransferase. |
| ywmF protein network | https://string-db.org/network/866895.HBHAL_3174 | Conserved hypothetical protein. |
| aadK protein network | https://string-db.org/network/866895.HBHAL_3175 | Aminoglycoside 6-adenylyltransferase. |
| CCG45521.1 protein network | https://string-db.org/network/866895.HBHAL_3176 | Hypothetical protein. |
| CCG45522.1 protein network | https://string-db.org/network/866895.HBHAL_3177 | DNA polymerase III epsilon subunit. |
| CCG45523.1 protein network | https://string-db.org/network/866895.HBHAL_3178 | Nitroreductase family protein. |
| CCG45524.1 protein network | https://string-db.org/network/866895.HBHAL_3179 | Acetyltransferase, GNAT family. |
| yycE protein network | https://string-db.org/network/866895.HBHAL_3180 | Glyoxalase domain protein. |
| CCG45526.1 protein network | https://string-db.org/network/866895.HBHAL_3181 | ABC-type transport system extracellular binding protein (probable substrate iron complex). |
| CCG45527.1 protein network | https://string-db.org/network/866895.HBHAL_3182 | Methionine sulfoxide reductase. |
| CCG45528.1 protein network | https://string-db.org/network/866895.HBHAL_3183 | Hypothetical protein. |
| yitL protein network | https://string-db.org/network/866895.HBHAL_3184 | Conserved hypothetical protein; Belongs to the CvfB family. |
| CCG45530.1 protein network | https://string-db.org/network/866895.HBHAL_3185 | Hypothetical protein. |
| yceB protein network | https://string-db.org/network/866895.HBHAL_3186 | Luciferase family oxidoreductase. |
| CCG45532.1 protein network | https://string-db.org/network/866895.HBHAL_3187 | Hypothetical protein. |
| CCG45533.1 protein network | https://string-db.org/network/866895.HBHAL_3188 | Alcohol dehydrogenase. |
| yocH1 protein network | https://string-db.org/network/866895.HBHAL_3189 | Conserved hypothetical protein. |
| CCG45535.1 protein network | https://string-db.org/network/866895.HBHAL_3190 | ABC-type transport system ATP-binding protein. |
| CCG45536.1 protein network | https://string-db.org/network/866895.HBHAL_3191 | Conserved hypothetical protein. |
| CCG45537.1 protein network | https://string-db.org/network/866895.HBHAL_3192 | Hypothetical protein. |
| CCG45538.1 protein network | https://string-db.org/network/866895.HBHAL_3193 | Cold shock protein. |
| sodC2 protein network | https://string-db.org/network/866895.HBHAL_3194 | Superoxide dismutase (Cu/Zn). |
| CCG45540.1 protein network | https://string-db.org/network/866895.HBHAL_3195 | Hypothetical protein. |
| CCG45541.1 protein network | https://string-db.org/network/866895.HBHAL_3196 | C45 family peptidase. |
| CCG45542.1 protein network | https://string-db.org/network/866895.HBHAL_3197 | Alpha/beta fold hydrolase. |
| ykqA protein network | https://string-db.org/network/866895.HBHAL_3198 | Hypothetical protein. |
| CCG45544.1 protein network | https://string-db.org/network/866895.HBHAL_3199 | S58/DmpA family peptidase. |
| yflL protein network | https://string-db.org/network/866895.HBHAL_3200 | Acylphosphatase. |
| CCG45546.1 protein network | https://string-db.org/network/866895.HBHAL_3201 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| CCG45547.1 protein network | https://string-db.org/network/866895.HBHAL_3202 | Ferredoxin; Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
| CCG45548.1 protein network | https://string-db.org/network/866895.HBHAL_3203 | Phosphoglycerate mutase family protein. |
| CCG45549.1 protein network | https://string-db.org/network/866895.HBHAL_3204 | Probable metal-dependent hydrolase. |
| yozC protein network | https://string-db.org/network/866895.HBHAL_3205 | Hypothetical protein. |
| mhqD protein network | https://string-db.org/network/866895.HBHAL_3206 | Probable hydrolase MhqD. |
| yhjN protein network | https://string-db.org/network/866895.HBHAL_3207 | Conserved hypothetical protein. |
| ykwB protein network | https://string-db.org/network/866895.HBHAL_3208 | Hypothetical protein. |
| CCG45554.1 protein network | https://string-db.org/network/866895.HBHAL_3209 | TetR family transcription regulator. |
| msrB protein network | https://string-db.org/network/866895.HBHAL_3210 | Peptide methionine sulfoxide reductase; Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methioni [...] |
| CCG45556.1 protein network | https://string-db.org/network/866895.HBHAL_3211 | Hypothetical protein. |
| ung protein network | https://string-db.org/network/866895.HBHAL_3212 | uracil-DNA glycosylase; Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine. |
| ytmB protein network | https://string-db.org/network/866895.HBHAL_3213 | Hypothetical protein. |
| sbcC protein network | https://string-db.org/network/866895.HBHAL_3214 | Exonuclease SbcC. |
| sbcD protein network | https://string-db.org/network/866895.HBHAL_3215 | Exonuclease SbcD; SbcCD cleaves DNA hairpin structures. These structures can inhibit DNA replication and are intermediates in certain DNA recombination reactions. The complex acts as a 3'->5' dou [...] |
| CCG45561.1 protein network | https://string-db.org/network/866895.HBHAL_3216 | UPF0346 family protein; Belongs to the UPF0346 family. |
| tatC protein network | https://string-db.org/network/866895.HBHAL_3217 | Sec-independent protein translocase protein TatC; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...] |
| tatA1 protein network | https://string-db.org/network/866895.HBHAL_3218 | Sec-independent protein translocase protein TatA; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...] |
| tatA2 protein network | https://string-db.org/network/866895.HBHAL_3219 | Sec-independent protein translocase protein TatA; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...] |
| mobA protein network | https://string-db.org/network/866895.HBHAL_3220 | Molybdopterin-guanine dinucleotide biosynthesis protein MobA; Transfers a GMP moiety from GTP to Mo-molybdopterin (Mo-MPT) cofactor (Moco or molybdenum cofactor) to form Mo-molybdopterin guanine [...] |
| CCG45566.1 protein network | https://string-db.org/network/866895.HBHAL_3221 | Dihydrofolate reductase; Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis. |
| thyA protein network | https://string-db.org/network/866895.HBHAL_3222 | Thymidylate synthase; Catalyzes the reductive methylation of 2'-deoxyuridine-5'- monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate ( [...] |
| CCG45568.1 protein network | https://string-db.org/network/866895.HBHAL_3223 | Conserved hypothetical protein. |
| yunF protein network | https://string-db.org/network/866895.HBHAL_3224 | Hypothetical protein. |
| fhs protein network | https://string-db.org/network/866895.HBHAL_3225 | Formate--tetrahydrofolate ligase; Belongs to the formate--tetrahydrofolate ligase family. |
| CCG45571.1 protein network | https://string-db.org/network/866895.HBHAL_3226 | Hypothetical protein. |
| CCG45572.1 protein network | https://string-db.org/network/866895.HBHAL_3227 | Cold shock protein. |
| ypdP protein network | https://string-db.org/network/866895.HBHAL_3228 | Conserved hypothetical protein; Involved in the import of queuosine (Q) precursors, required for Q precursor salvage; Belongs to the vitamin uptake transporter (VUT/ECF) (TC 2.A.88) family. Q pre [...] |
| rnhA protein network | https://string-db.org/network/866895.HBHAL_3229 | Ribonuclease H. |
| CCG45575.1 protein network | https://string-db.org/network/866895.HBHAL_3230 | Hypothetical protein. |
| CCG45576.1 protein network | https://string-db.org/network/866895.HBHAL_3231 | Hypothetical protein. |
| CCG45577.1 protein network | https://string-db.org/network/866895.HBHAL_3231_A | Conserved hypothetical protein. |
| bcsA protein network | https://string-db.org/network/866895.HBHAL_3232 | Naringenin-chalcone synthase. |
| CCG45579.1 protein network | https://string-db.org/network/866895.HBHAL_3233 | Short-chain dehydrogenase/reductase family protein. |
| CCG45580.1 protein network | https://string-db.org/network/866895.HBHAL_3234 | Hypothetical protein. |
| ypwA protein network | https://string-db.org/network/866895.HBHAL_3235 | Thermostable carboxypeptidase 1; Broad specificity carboxypetidase that releases amino acids sequentially from the C-terminus, including neutral, aromatic, polar and basic residues. |
| CCG45582.1 protein network | https://string-db.org/network/866895.HBHAL_3236 | Conserved hypothetical protein; Belongs to the methyltransferase superfamily. |
| gpsB protein network | https://string-db.org/network/866895.HBHAL_3237 | Cell cycle protein GpsB; Divisome component that associates with the complex late in its assembly, after the Z-ring is formed, and is dependent on DivIC and PBP2B for its recruitment to the divis [...] |
| CCG45584.1 protein network | https://string-db.org/network/866895.HBHAL_3238 | UPF0398 family protein; Belongs to the UPF0398 family. |
| CCG45585.1 protein network | https://string-db.org/network/866895.HBHAL_3239 | Hypothetical protein. |
| cdd protein network | https://string-db.org/network/866895.HBHAL_3241 | Cytidine deaminase; This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis; Belongs to the cytidine and deoxycytidylate deaminase family. |
| CCG45587.1 protein network | https://string-db.org/network/866895.HBHAL_3242 | Acriflavin resistance protein family transporter; Belongs to the resistance-nodulation-cell division (RND) (TC 2.A.6) family. |
| CCG45588.1 protein network | https://string-db.org/network/866895.HBHAL_3243 | Hypothetical protein. |
| CCG45589.1 protein network | https://string-db.org/network/866895.HBHAL_3244 | Hypothetical protein. |
| CCG45590.1 protein network | https://string-db.org/network/866895.HBHAL_3245 | Hypothetical protein. |
| recU protein network | https://string-db.org/network/866895.HBHAL_3246 | Holliday junction-specific endonuclease; Endonuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves mobile four-strand junctions by introducing symmetrical nicks [...] |
| ponA protein network | https://string-db.org/network/866895.HBHAL_3247 | Penicillin-binding proteins 1A/1B. |
| nth protein network | https://string-db.org/network/866895.HBHAL_3248 | Endonuclease III; DNA repair enzyme that has both DNA N-glycosylase activity and AP-lyase activity. The DNA N-glycosylase activity releases various damaged pyrimidines from DNA by cleaving the N- [...] |
| dnaD protein network | https://string-db.org/network/866895.HBHAL_3249 | DNA replication protein DnaD. |
| asnS protein network | https://string-db.org/network/866895.HBHAL_3250 | asparaginyl-tRNA synthetase. |
| CCG45596.1 protein network | https://string-db.org/network/866895.HBHAL_3251 | Aspartate aminotransferase. |
| CCG45597.1 protein network | https://string-db.org/network/866895.HBHAL_3252 | Hypothetical protein. |
| ypmA protein network | https://string-db.org/network/866895.HBHAL_3253 | Conserved hypothetical protein. |
| dinG protein network | https://string-db.org/network/866895.HBHAL_3254 | Bifunctional ATP-dependent DNA helicase DinG / DnaQ family exonuclease; 3'-5' exonuclease. |
| panD protein network | https://string-db.org/network/866895.HBHAL_3255 | Aspartate 1-decarboxylase; Catalyzes the pyruvoyl-dependent decarboxylation of aspartate to produce beta-alanine. |
| panC protein network | https://string-db.org/network/866895.HBHAL_3256 | Pantoate-beta-alanine ligase; Catalyzes the condensation of pantoate with beta-alanine in an ATP-dependent reaction via a pantoyl-adenylate intermediate. Belongs to the pantothenate synthetase fa [...] |
| panB protein network | https://string-db.org/network/866895.HBHAL_3257 | 3-methyl-2-oxobutanoatehydroxymethyltransferase; Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha- ketoisovalerate to f [...] |
| birA protein network | https://string-db.org/network/866895.HBHAL_3257_A | Biotin [acetyl-CoA carboxylase] ligase; Acts both as a biotin--[acetyl-CoA-carboxylase] ligase and a repressor; Belongs to the biotin--protein ligase family. |
| cca protein network | https://string-db.org/network/866895.HBHAL_3258 | CCA-adding enzyme. |
| CCG45605.1 protein network | https://string-db.org/network/866895.HBHAL_3259 | Group 1 glycosyltransferase. |
| mgsA protein network | https://string-db.org/network/866895.HBHAL_3260 | Methylglyoxal synthase; Catalyzes the formation of methylglyoxal from dihydroxyacetone phosphate. |
| dapB protein network | https://string-db.org/network/866895.HBHAL_3261 | Dihydrodipicolinate reductase; Catalyzes the conversion of 4-hydroxy-tetrahydrodipicolinate (HTPA) to tetrahydrodipicolinate; Belongs to the DapB family. |
| ypjD protein network | https://string-db.org/network/866895.HBHAL_3262 | Hypothetical protein. |
| CCG45609.1 protein network | https://string-db.org/network/866895.HBHAL_3263 | Conserved hypothetical protein. |
| CCG45610.1 protein network | https://string-db.org/network/866895.HBHAL_3264 | Conserved hypothetical protein. |
| CCG45611.1 protein network | https://string-db.org/network/866895.HBHAL_3265 | Hypothetical protein. |
| CCG45612.1 protein network | https://string-db.org/network/866895.HBHAL_3266 | Conserved hypothetical protein. |
| qcrC protein network | https://string-db.org/network/866895.HBHAL_3267 | Menaquinol-cytochrome c reductase cytochrome b/c subunit. |
| qcrB protein network | https://string-db.org/network/866895.HBHAL_3268 | Menaquinol-cytochrome c reductase cytochrome b subunit. |
| qcrA protein network | https://string-db.org/network/866895.HBHAL_3269 | Menaquinol-cytochrome c reductase iron-sulfur subunit. |
| ypiF protein network | https://string-db.org/network/866895.HBHAL_3270 | Hypothetical protein. |
| ypiB protein network | https://string-db.org/network/866895.HBHAL_3271 | Hypothetical protein; Belongs to the UPF0302 family. |
| ypiA protein network | https://string-db.org/network/866895.HBHAL_3272 | Hypothetical protein. |
| CCG45619.1 protein network | https://string-db.org/network/866895.HBHAL_3273 | Hypothetical protein. |
| aroA protein network | https://string-db.org/network/866895.HBHAL_3274 | 3-phosphoshikimate 1-carboxyvinyltransferase; Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl [...] |
| tyrA protein network | https://string-db.org/network/866895.HBHAL_3275 | Prephenate dehydrogenase. |
| hisC-2 protein network | https://string-db.org/network/866895.HBHAL_3276 | Histidinol-phosphate aminotransferase; Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. Histidinol-phosphate aminotransferase subfamily. |
| aroH protein network | https://string-db.org/network/866895.HBHAL_3277 | Chorismate mutase; Catalyzes the Claisen rearrangement of chorismate to prephenate. Probably involved in the aromatic amino acid biosynthesis. |
| aroB protein network | https://string-db.org/network/866895.HBHAL_3278 | 3-dehydroquinate synthase; Catalyzes the conversion of 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) to dehydroquinate (DHQ). |
| aroF protein network | https://string-db.org/network/866895.HBHAL_3279 | Chorismate synthase; Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch poin [...] |
| cheR protein network | https://string-db.org/network/866895.HBHAL_3280 | Chemotaxis protein methyltransferase. |
| ndk protein network | https://string-db.org/network/866895.HBHAL_3281 | Nucleoside diphosphate kinase; Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, [...] |
| hepT protein network | https://string-db.org/network/866895.HBHAL_3282 | Heptaprenyl diphosphate synthase component II; Belongs to the FPP/GGPP synthase family. |
| menG protein network | https://string-db.org/network/866895.HBHAL_3283 | Ubiquinone/menaquinone biosynthesis methyltransferase; Methyltransferase required for the conversion of demethylmenaquinol (DMKH2) to menaquinol (MKH2). |
| hepS protein network | https://string-db.org/network/866895.HBHAL_3284 | Heptaprenyl diphosphate synthase component I. |
| mtrB protein network | https://string-db.org/network/866895.HBHAL_3285 | Transcription attenuation protein MtrB; Required for transcription attenuation control in the Trp operon. This trans-acting factor seems to recognize a 10 bases nucleotide sequence in the Trp lea [...] |
| hupA protein network | https://string-db.org/network/866895.HBHAL_3286 | DNA-binding protein HU; Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions. |
| CCG45633.1 protein network | https://string-db.org/network/866895.HBHAL_3287 | Stage IV sporulation protein A; ATPase. Has a role at an early stage in the morphogenesis of the spore coat. |
| CCG45634.1 protein network | https://string-db.org/network/866895.HBHAL_3288 | Hypothetical protein. |
| CCG45635.1 protein network | https://string-db.org/network/866895.HBHAL_3289 | Hypothetical protein. |
| CCG45636.1 protein network | https://string-db.org/network/866895.HBHAL_3290 | Hypothetical protein. |
| yjcC2 protein network | https://string-db.org/network/866895.HBHAL_3291 | YjcC family transcription regulator. |
| gpsA protein network | https://string-db.org/network/866895.HBHAL_3292 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. |
| der protein network | https://string-db.org/network/866895.HBHAL_3293 | GTP-binding protein EngA; GTPase that plays an essential role in the late steps of ribosome biogenesis; Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. EngA (Der) G [...] |
| CCG45640.1 protein network | https://string-db.org/network/866895.HBHAL_3294 | Hypothetical protein. |
| CCG45641.1 protein network | https://string-db.org/network/866895.HBHAL_3295 | Conserved hypothetical protein. |
| CCG45642.1 protein network | https://string-db.org/network/866895.HBHAL_3296 | Hypothetical protein. |
| fni protein network | https://string-db.org/network/866895.HBHAL_3297 | Isopentenyl pyrophosphate isomerase; Involved in the biosynthesis of isoprenoids. Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its allylic isomer, dim [...] |
| rpsA protein network | https://string-db.org/network/866895.HBHAL_3298 | 30S ribosomal protein S1. |
| plsC protein network | https://string-db.org/network/866895.HBHAL_3299 | 1-acylglycerol-3-phosphate O-acyltransferase. |
| cmk protein network | https://string-db.org/network/866895.HBHAL_3300 | Cytidylate kinase. |
| ypfA protein network | https://string-db.org/network/866895.HBHAL_3301 | Hypothetical protein. |
| CCG45648.1 protein network | https://string-db.org/network/866895.HBHAL_3302 | Putative spore germination protein. |
| CCG45649.1 protein network | https://string-db.org/network/866895.HBHAL_3303 | Spore cortex-lytic enzyme prepeptide. |
| prsW protein network | https://string-db.org/network/866895.HBHAL_3304 | Protease PrsW; Involved in the degradation of specific anti-sigma factors. Belongs to the protease PrsW family. |
| CCG45651.1 protein network | https://string-db.org/network/866895.HBHAL_3305 | Hypothetical protein. |
| ansA protein network | https://string-db.org/network/866895.HBHAL_3306 | L-asparaginase. |
| CCG45653.1 protein network | https://string-db.org/network/866895.HBHAL_3307 | FAD-dependent oxidoreductase. |
| gdh1 protein network | https://string-db.org/network/866895.HBHAL_3308 | Glutamate dehydrogenase; Belongs to the Glu/Leu/Phe/Val dehydrogenases family. |
| ddlA protein network | https://string-db.org/network/866895.HBHAL_3309 | D-alanine--D-alanine ligase; Cell wall formation; Belongs to the D-alanine--D-alanine ligase family. |
| CCG45656.1 protein network | https://string-db.org/network/866895.HBHAL_3310 | Adaptor protein; Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis; Belongs to the MecA family. |
| CCG45657.1 protein network | https://string-db.org/network/866895.HBHAL_3311 | MerR family transcription regulator. |
| ypbG protein network | https://string-db.org/network/866895.HBHAL_3312 | Phosphoesterase. |
| CCG45659.1 protein network | https://string-db.org/network/866895.HBHAL_3313 | CBS domain protein. |
| CCG45660.1 protein network | https://string-db.org/network/866895.HBHAL_3315 | Spore coat protein. |
| CCG45661.1 protein network | https://string-db.org/network/866895.HBHAL_3316 | Spore coat protein. |
| CCG45662.1 protein network | https://string-db.org/network/866895.HBHAL_3317 | Hypothetical protein. |
| ypbD protein network | https://string-db.org/network/866895.HBHAL_3318 | Conserved hypothetical protein. |
| recS protein network | https://string-db.org/network/866895.HBHAL_3319 | Probable ATP-dependent DNA helicase RecS. |
| ypbB protein network | https://string-db.org/network/866895.HBHAL_3320 | Conserved hypothetical protein. |
| fer protein network | https://string-db.org/network/866895.HBHAL_3321 | Ferredoxin. |
| CCG45667.1 protein network | https://string-db.org/network/866895.HBHAL_3322 | Hypothetical protein. |
| CCG45668.1 protein network | https://string-db.org/network/866895.HBHAL_3323 | RsiX type transcription regulator. |
| sigX protein network | https://string-db.org/network/866895.HBHAL_3324 | RNA polymerase sigma factor SigX; Belongs to the sigma-70 factor family. ECF subfamily. |
| CCG45671.1 protein network | https://string-db.org/network/866895.HBHAL_3326 | Hypothetical protein. |
| CCG45672.1 protein network | https://string-db.org/network/866895.HBHAL_3327 | Hypothetical protein. |
| CCG45673.1 protein network | https://string-db.org/network/866895.HBHAL_3328 | Two-component sensor histidine kinase. |
| CCG45674.1 protein network | https://string-db.org/network/866895.HBHAL_3329 | Two-component response regulator. |
| resC protein network | https://string-db.org/network/866895.HBHAL_3330 | Cytochrome c biogenesis protein ResC. |
| resB protein network | https://string-db.org/network/866895.HBHAL_3331 | Cytochrome c biogenesis protein ResB. |
| resA protein network | https://string-db.org/network/866895.HBHAL_3332 | Thiol-disulfide oxidoreductase ResA. |
| rluB protein network | https://string-db.org/network/866895.HBHAL_3333 | 23S rRNA pseudouridine synthase; Belongs to the pseudouridine synthase RsuA family. |
| CCG45679.1 protein network | https://string-db.org/network/866895.HBHAL_3334 | Spore maturation protein B. |
| CCG45680.1 protein network | https://string-db.org/network/866895.HBHAL_3335 | Spore maturation protein A. |
| dacB protein network | https://string-db.org/network/866895.HBHAL_3336 | D-alanyl-D-alanine carboxypeptidase; Belongs to the peptidase S11 family. |
| scpB protein network | https://string-db.org/network/866895.HBHAL_3337 | Segregation and condensation protein B; Participates in chromosomal partition during cell division. May act via the formation of a condensin-like complex containing Smc and ScpA that pull DNA awa [...] |
| scpA protein network | https://string-db.org/network/866895.HBHAL_3338 | Segregation and condensation protein A; Participates in chromosomal partition during cell division. May act via the formation of a condensin-like complex containing Smc and ScpB that pull DNA awa [...] |
| ypuF protein network | https://string-db.org/network/866895.HBHAL_3339 | Conserved hypothetical protein. |
| ribT protein network | https://string-db.org/network/866895.HBHAL_3340 | Riboflavin biosynthesis protein RibT. |
| CCG45686.1 protein network | https://string-db.org/network/866895.HBHAL_3341 | Hypothetical protein. |
| ppiB protein network | https://string-db.org/network/866895.HBHAL_3342 | Peptidylprolyl isomerase; PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides; Belongs to the cyclophilin-type PP [...] |
| lysA protein network | https://string-db.org/network/866895.HBHAL_3343 | Diaminopimelate decarboxylase; Specifically catalyzes the decarboxylation of meso- diaminopimelate (meso-DAP) to L-lysine. |
| CCG45689.1 protein network | https://string-db.org/network/866895.HBHAL_3344 | Stage V sporulation protein AF. |
| CCG45690.1 protein network | https://string-db.org/network/866895.HBHAL_3345 | Stage V sporulation protein AE. |
| CCG45691.1 protein network | https://string-db.org/network/866895.HBHAL_3346 | Stage V sporulation protein AD. |
| CCG45692.1 protein network | https://string-db.org/network/866895.HBHAL_3347 | Stage V sporulation protein AC. |
| CCG45693.1 protein network | https://string-db.org/network/866895.HBHAL_3348 | Stage V sporulation protein AB. |
| CCG45694.1 protein network | https://string-db.org/network/866895.HBHAL_3349 | Stage V sporulation protein AA. |
| sigF protein network | https://string-db.org/network/866895.HBHAL_3350 | RNA polymerase sigma factor SigF; Belongs to the sigma-70 factor family. |
| spoIIAB protein network | https://string-db.org/network/866895.HBHAL_3351 | Anti-sigma F factor; Binds to sigma F and blocks its ability to form an RNA polymerase holoenzyme (E-sigma F). Phosphorylates SpoIIAA on a serine residue. This phosphorylation may enable SpoIIAA [...] |
| CCG45697.1 protein network | https://string-db.org/network/866895.HBHAL_3352 | Anti-sigma F factor antagonist; Belongs to the anti-sigma-factor antagonist family. |
| dacF protein network | https://string-db.org/network/866895.HBHAL_3353 | Serine-type D-Ala-D-Ala carboxypeptidase; Belongs to the peptidase S11 family. |
| CCG45699.1 protein network | https://string-db.org/network/866895.HBHAL_3354 | Hypothetical protein. |
| pyn protein network | https://string-db.org/network/866895.HBHAL_3355 | Pyrimidine-nucleoside phosphorylase. |
| punA protein network | https://string-db.org/network/866895.HBHAL_3356 | Purine nucleoside phosphorylase; The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta- (deoxy)ribonucleoside molecules, with the formati [...] |
| deoB protein network | https://string-db.org/network/866895.HBHAL_3357 | Phosphopentomutase; Phosphotransfer between the C1 and C5 carbon atoms of pentose; Belongs to the phosphopentomutase family. |
| xerD protein network | https://string-db.org/network/866895.HBHAL_3358 | Site-specific tyrosine recombinase XerD; Site-specific tyrosine recombinase, which acts by catalyzing the cutting and rejoining of the recombining DNA molecules. The XerC- XerD complex is essenti [...] |
| CCG45704.1 protein network | https://string-db.org/network/866895.HBHAL_3359 | Fur family transcription regulator; Belongs to the Fur family. |
| CCG45705.1 protein network | https://string-db.org/network/866895.HBHAL_3360 | Stage II sporulation protein M; Required for complete septum migration and engulfment of the forespore compartment during sporulation. Required for stabilizing and recruiting of SpoIIP to the sep [...] |
| nudF protein network | https://string-db.org/network/866895.HBHAL_3361 | ADP-ribose pyrophosphatase. |
| CCG45707.1 protein network | https://string-db.org/network/866895.HBHAL_3362 | Aldo/keto reductase family protein. |
| CCG45708.1 protein network | https://string-db.org/network/866895.HBHAL_3363 | Membrane dipeptidase. |
| CCG45709.1 protein network | https://string-db.org/network/866895.HBHAL_3364 | Hypothetical protein. |
| CCG45710.1 protein network | https://string-db.org/network/866895.HBHAL_3365 | Group 1 glycosyltransferase. |
| CCG45711.1 protein network | https://string-db.org/network/866895.HBHAL_3366 | Putative MFS-type transporter; Belongs to the major facilitator superfamily. |
| CCG45712.1 protein network | https://string-db.org/network/866895.HBHAL_3367 | D-amino-acid dehydrogenase. |
| CCG45713.1 protein network | https://string-db.org/network/866895.HBHAL_3368 | ABC-type transport system extracellular binding protein (probable substrate peptide/nickel). |
| sppA protein network | https://string-db.org/network/866895.HBHAL_3369 | Probable signal peptide peptidase SppA. |
| yteJ protein network | https://string-db.org/network/866895.HBHAL_3370 | RDD domain protein. |
| cypA protein network | https://string-db.org/network/866895.HBHAL_3372 | Cytochrome P450. |
| CCG45717.1 protein network | https://string-db.org/network/866895.HBHAL_3373 | IS150-type transposase orfAB. |
| CCG45718.1 protein network | https://string-db.org/network/866895.HBHAL_3375 | Na+/H+ antiporter family protein. |
| CCG45719.1 protein network | https://string-db.org/network/866895.HBHAL_3376 | C60 family peptidase. |
| CCG45720.1 protein network | https://string-db.org/network/866895.HBHAL_3377 | Conserved hypothetical protein. |
| CCG45721.1 protein network | https://string-db.org/network/866895.HBHAL_3378 | Conserved hypothetical protein. |
| CCG45722.1 protein network | https://string-db.org/network/866895.HBHAL_3379 | Acetyltransferase, GNAT family. |
| CCG45723.1 protein network | https://string-db.org/network/866895.HBHAL_3380 | Hypothetical protein. |
| CCG45724.1 protein network | https://string-db.org/network/866895.HBHAL_3381 | GntR family transcription regulator. |
| CCG45725.1 protein network | https://string-db.org/network/866895.HBHAL_3382 | Hypothetical protein. |
| CCG45726.1 protein network | https://string-db.org/network/866895.HBHAL_3383 | Hypothetical protein. |
| CCG45728.1 protein network | https://string-db.org/network/866895.HBHAL_3385 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| metQ2 protein network | https://string-db.org/network/866895.HBHAL_3386 | ABC-type transport system extracellular binding protein (probable substrate methionine); Belongs to the nlpA lipoprotein family. |
| metP2 protein network | https://string-db.org/network/866895.HBHAL_3387 | ABC-type transport system permease protein (probable substrate methionine). |
| metN2 protein network | https://string-db.org/network/866895.HBHAL_3388 | ABC-type transport system ATP-binding protein (probable substrate methionine); Part of the ABC transporter complex MetNIQ involved in methionine import. Responsible for energy coupling to the tra [...] |
| CCG45732.1 protein network | https://string-db.org/network/866895.HBHAL_3389 | Alcohol dehydrogenase. |
| CCG45733.1 protein network | https://string-db.org/network/866895.HBHAL_3390 | Hypothetical protein. |
| CCG45734.1 protein network | https://string-db.org/network/866895.HBHAL_3391 | Hypothetical protein. |
| CCG45735.1 protein network | https://string-db.org/network/866895.HBHAL_3392 | Putative dioxygenase. |
| CCG45736.1 protein network | https://string-db.org/network/866895.HBHAL_3393 | Conserved hypothetical protein. |
| CCG45737.1 protein network | https://string-db.org/network/866895.HBHAL_3394 | Hypothetical protein. |
| CCG45738.1 protein network | https://string-db.org/network/866895.HBHAL_3395 | Hypothetical protein. |
| CCG45739.1 protein network | https://string-db.org/network/866895.HBHAL_3396 | Hypothetical protein. |
| CCG45740.1 protein network | https://string-db.org/network/866895.HBHAL_3397 | Hypothetical protein. |
| CCG45741.1 protein network | https://string-db.org/network/866895.HBHAL_3398 | Fibronectin-binding protein, putative. |
| CCG45742.1 protein network | https://string-db.org/network/866895.HBHAL_3399 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase. |
| CCG45743.1 protein network | https://string-db.org/network/866895.HBHAL_3399_A | Conserved hypothetical protein. |
| CCG45744.1 protein network | https://string-db.org/network/866895.HBHAL_3400 | Hypothetical protein. |
| ykuD protein network | https://string-db.org/network/866895.HBHAL_3401 | Hypothetical protein. |
| CCG45746.1 protein network | https://string-db.org/network/866895.HBHAL_3402 | RNaseH domain protein. |
| CCG45747.1 protein network | https://string-db.org/network/866895.HBHAL_3403 | Hypothetical protein. |
| CCG45748.1 protein network | https://string-db.org/network/866895.HBHAL_3404 | Hypothetical protein. |
| yvbT protein network | https://string-db.org/network/866895.HBHAL_3405 | Luciferase family oxidoreductase. |
| ectD protein network | https://string-db.org/network/866895.HBHAL_3406 | Ectoine hydroxylase. |
| CCG45751.1 protein network | https://string-db.org/network/866895.HBHAL_3407 | Hypothetical protein. |
| CCG45752.1 protein network | https://string-db.org/network/866895.HBHAL_3408 | ABC-type transport system ATP-binding protein. |
| CCG45753.1 protein network | https://string-db.org/network/866895.HBHAL_3409 | Acetyltransferase, GNAT family. |
| CCG45754.1 protein network | https://string-db.org/network/866895.HBHAL_3410 | Hypothetical protein. |
| CCG45755.1 protein network | https://string-db.org/network/866895.HBHAL_3411 | Conserved hypothetical protein. |
| CCG45756.1 protein network | https://string-db.org/network/866895.HBHAL_3412 | Hypothetical protein. |
| CCG45757.1 protein network | https://string-db.org/network/866895.HBHAL_3413 | Hypothetical protein. |
| CCG45758.1 protein network | https://string-db.org/network/866895.HBHAL_3414 | Hypothetical protein. |
| CCG45759.1 protein network | https://string-db.org/network/866895.HBHAL_3415 | Hypothetical protein. |
| CCG45760.1 protein network | https://string-db.org/network/866895.HBHAL_3416 | Hypothetical protein. |
| CCG45761.1 protein network | https://string-db.org/network/866895.HBHAL_3417 | Hypothetical protein. |
| thiF protein network | https://string-db.org/network/866895.HBHAL_3418 | Thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein. |
| thiG protein network | https://string-db.org/network/866895.HBHAL_3419 | Thiazole synthase; Catalyzes the rearrangement of 1-deoxy-D-xylulose 5-phosphate (DXP) to produce the thiazole phosphate moiety of thiamine. Sulfur is provided by the thiocarboxylate moiety of th [...] |
| thiS protein network | https://string-db.org/network/866895.HBHAL_3420 | ThiS protein. |
| CCG45765.1 protein network | https://string-db.org/network/866895.HBHAL_3421 | Glycine oxidase. |
| CCG45766.1 protein network | https://string-db.org/network/866895.HBHAL_3422 | tenI family protein. |
| CCG45767.1 protein network | https://string-db.org/network/866895.HBHAL_3423 | Na+/Ca2+ antiporter family protein. |
| CCG45768.1 protein network | https://string-db.org/network/866895.HBHAL_3424 | Hypothetical protein. |
| CCG45769.1 protein network | https://string-db.org/network/866895.HBHAL_3425 | Hypothetical protein; Belongs to the HesB/IscA family. |
| CCG45770.1 protein network | https://string-db.org/network/866895.HBHAL_3426 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| CCG45771.1 protein network | https://string-db.org/network/866895.HBHAL_3427 | Zn-dependent hydrolase. |
| CCG45772.1 protein network | https://string-db.org/network/866895.HBHAL_3428 | Putative AbgT transporter family protein. |
| CCG45773.1 protein network | https://string-db.org/network/866895.HBHAL_3429 | M20 family peptidase. |
| glpQ protein network | https://string-db.org/network/866895.HBHAL_3430 | Glycerophosphoryl diester phosphodiesterase. |
| CCG45775.1 protein network | https://string-db.org/network/866895.HBHAL_3431 | Group 2 glycosyltransferase. |
| namA protein network | https://string-db.org/network/866895.HBHAL_3432 | NAD(P)H dehydrogenase; Catalyzes the reduction of the double bond of an array of alpha,beta-unsaturated aldehydes and ketones. It also reduces the nitro group of nitroester and nitroaromatic comp [...] |
| CCG45777.1 protein network | https://string-db.org/network/866895.HBHAL_3433 | Hypothetical protein. |
| rnz protein network | https://string-db.org/network/866895.HBHAL_3434 | Ribonuclease Z; Zinc phosphodiesterase, which displays some tRNA 3'- processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA; Belongs [...] |
| CCG45779.1 protein network | https://string-db.org/network/866895.HBHAL_3435 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| CCG45780.1 protein network | https://string-db.org/network/866895.HBHAL_3436 | IS1341-type transposase. |
| CCG45781.1 protein network | https://string-db.org/network/866895.HBHAL_3437 | Hypothetical protein. |
| CCG45782.1 protein network | https://string-db.org/network/866895.HBHAL_3438 | Hypothetical protein. |
| ycgF protein network | https://string-db.org/network/866895.HBHAL_3439 | Hypothetical protein. |
| ycgH protein network | https://string-db.org/network/866895.HBHAL_3440 | Transport protein. |
| CCG45785.1 protein network | https://string-db.org/network/866895.HBHAL_3441 | Hypothetical protein. |
| CCG45786.1 protein network | https://string-db.org/network/866895.HBHAL_3442 | Hypothetical protein. |
| yqjH protein network | https://string-db.org/network/866895.HBHAL_3443 | DNA polymerase IV; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misa [...] |
| CCG45788.1 protein network | https://string-db.org/network/866895.HBHAL_3444 | Peptidase. |
| CCG45789.1 protein network | https://string-db.org/network/866895.HBHAL_3445 | Carboxyl transferase. |
| CCG45790.1 protein network | https://string-db.org/network/866895.HBHAL_3446 | methylmalonyl-CoA mutase small subunit. |
| CCG45791.1 protein network | https://string-db.org/network/866895.HBHAL_3447 | methylmalonyl-CoA mutase large subunit. |
| CCG45792.1 protein network | https://string-db.org/network/866895.HBHAL_3448 | Hypothetical protein. |
| CCG45793.1 protein network | https://string-db.org/network/866895.HBHAL_3449 | Conserved hypothetical protein. |
| CCG45794.1 protein network | https://string-db.org/network/866895.HBHAL_3450 | IS1341-type transposase. |
| yqjA protein network | https://string-db.org/network/866895.HBHAL_3451 | Hypothetical protein. |
| yqiW protein network | https://string-db.org/network/866895.HBHAL_3452 | Hypothetical protein; Belongs to the UPF0403 family. |
| CCG45798.1 protein network | https://string-db.org/network/866895.HBHAL_3454 | Dihydrolipoamide acetyltransferase. |
| CCG45799.1 protein network | https://string-db.org/network/866895.HBHAL_3455 | 3-methyl-2-oxobutanoate dehydrogenase beta subunit. |
| CCG45800.1 protein network | https://string-db.org/network/866895.HBHAL_3456 | 3-methyl-2-oxobutanoate dehydrogenase alpha subunit. |
| lpdV protein network | https://string-db.org/network/866895.HBHAL_3457 | Dihydrolipoamide dehydrogenase. |
| buk protein network | https://string-db.org/network/866895.HBHAL_3458 | Butyrate kinase; Belongs to the acetokinase family. |
| ldh protein network | https://string-db.org/network/866895.HBHAL_3459 | Leucine dehydrogenase; Belongs to the Glu/Leu/Phe/Val dehydrogenases family. |
| yqiS protein network | https://string-db.org/network/866895.HBHAL_3460 | Phosphate butyryltransferase. |
| yqiR protein network | https://string-db.org/network/866895.HBHAL_3461 | YqiR family transcription regulator. |
| CCG45806.1 protein network | https://string-db.org/network/866895.HBHAL_3462 | Hypothetical protein. |
| CCG45807.1 protein network | https://string-db.org/network/866895.HBHAL_3463 | Conserved hypothetical protein. |
| CCG45808.1 protein network | https://string-db.org/network/866895.HBHAL_3464 | DNA polymerase III epsilon subunit. |
| dapG2 protein network | https://string-db.org/network/866895.HBHAL_3465 | Aspartate kinase; Belongs to the aspartokinase family. |
| CCG45810.1 protein network | https://string-db.org/network/866895.HBHAL_3466 | Two-component response regulator; May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response [...] |
| CCG45811.1 protein network | https://string-db.org/network/866895.HBHAL_3467 | Stage IV sporulation protein B. |
| recN protein network | https://string-db.org/network/866895.HBHAL_3468 | DNA repair protein RecN; May be involved in recombinational repair of damaged DNA. |
| argR protein network | https://string-db.org/network/866895.HBHAL_3469 | Arginine repressor; Regulates arginine biosynthesis genes. |
| yqxC protein network | https://string-db.org/network/866895.HBHAL_3470 | Conserved hypothetical protein. |
| dxs protein network | https://string-db.org/network/866895.HBHAL_3471 | 1-deoxy-D-xylulose-5-phosphate synthase; Catalyzes the acyloin condensation reaction between C atoms 2 and 3 of pyruvate and glyceraldehyde 3-phosphate to yield 1-deoxy-D- xylulose-5-phosphate (D [...] |
| CCG45816.1 protein network | https://string-db.org/network/866895.HBHAL_3472 | Conserved hypothetical protein. |
| CCG45817.1 protein network | https://string-db.org/network/866895.HBHAL_3473 | Hypothetical protein. |
| yqiD protein network | https://string-db.org/network/866895.HBHAL_3474 | Geranyltranstransferase; Belongs to the FPP/GGPP synthase family. |
| xseB protein network | https://string-db.org/network/866895.HBHAL_3475 | Exodeoxyribonuclease VII small subunit; Bidirectionally degrades single-stranded DNA into large acid- insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucl [...] |
| xseA protein network | https://string-db.org/network/866895.HBHAL_3476 | Exodeoxyribonuclease VII large subunit; Bidirectionally degrades single-stranded DNA into large acid- insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucl [...] |
| folD protein network | https://string-db.org/network/866895.HBHAL_3477 | Methenyltetrahydrofolate cyclohydrolase; Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10- methenyltetrahydrofolate to 10 [...] |
| nusB protein network | https://string-db.org/network/866895.HBHAL_3478 | Transcription antitermination protein NusB; Involved in transcription antitermination. Required for transcription of ribosomal RNA (rRNA) genes. Binds specifically to the boxA antiterminator sequ [...] |
| yqhY protein network | https://string-db.org/network/866895.HBHAL_3479 | Hypothetical protein. |
| accC protein network | https://string-db.org/network/866895.HBHAL_3480 | acetyl-CoA carboxylase biotin carboxylase subunit; This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier p [...] |
| accB protein network | https://string-db.org/network/866895.HBHAL_3481 | acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of [...] |
| CCG45826.1 protein network | https://string-db.org/network/866895.HBHAL_3482 | Stage III sporulation protein AH. |
| CCG45827.1 protein network | https://string-db.org/network/866895.HBHAL_3483 | Stage III sporulation protein AG. |
| CCG45828.1 protein network | https://string-db.org/network/866895.HBHAL_3484 | Stage III sporulation protein AF. |
| CCG45829.1 protein network | https://string-db.org/network/866895.HBHAL_3485 | Stage III sporulation protein AE. |
| CCG45830.1 protein network | https://string-db.org/network/866895.HBHAL_3486 | Stage III sporulation protein AD. |
| CCG45831.1 protein network | https://string-db.org/network/866895.HBHAL_3487 | Stage III sporulation protein AC. |
| CCG45832.1 protein network | https://string-db.org/network/866895.HBHAL_3488 | Stage III sporulation protein SpoAB. |
| CCG45833.1 protein network | https://string-db.org/network/866895.HBHAL_3489 | Stage III sporulation protein AA. |
| efp protein network | https://string-db.org/network/866895.HBHAL_3490 | Elongation factor P; Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirect [...] |
| CCG45835.1 protein network | https://string-db.org/network/866895.HBHAL_3491 | M24 family peptidase C-term region. |
| CCG45836.1 protein network | https://string-db.org/network/866895.HBHAL_3492 | M24 family peptidase N-term region. |
| aroQ protein network | https://string-db.org/network/866895.HBHAL_3493 | 3-dehydroquinate dehydratase; Catalyzes a trans-dehydration via an enolate intermediate. Belongs to the type-II 3-dehydroquinase family. |
| yqhR protein network | https://string-db.org/network/866895.HBHAL_3494 | Hypothetical protein. |
| CCG45839.1 protein network | https://string-db.org/network/866895.HBHAL_3495 | Hypothetical protein. |
| yqhO protein network | https://string-db.org/network/866895.HBHAL_3496 | NTE family protein. |
| mntR protein network | https://string-db.org/network/866895.HBHAL_3497 | Iron-dependent repressor family protein; Central regulator of manganese homeostasis. Belongs to the DtxR/MntR family. |
| CCG45842.1 protein network | https://string-db.org/network/866895.HBHAL_3498 | Ribonucleotide-diphosphate reductase alpha subunit C-terminal domain. |
| CCG45843.1 protein network | https://string-db.org/network/866895.HBHAL_3499 | Ribonucleotide-diphosphate reductase alpha subunit N-terminal domain. |
| yqhL protein network | https://string-db.org/network/866895.HBHAL_3500 | Rhodanese domain protein. |
| gcvPB protein network | https://string-db.org/network/866895.HBHAL_3501 | Glycine dehydrogenase subunit 2; The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; C [...] |
| gcvPA protein network | https://string-db.org/network/866895.HBHAL_3502 | Glycine dehydrogenase subunit 1; The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; C [...] |
| gcvT protein network | https://string-db.org/network/866895.HBHAL_3503 | Aminomethyltransferase; The glycine cleavage system catalyzes the degradation of glycine. |
| CCG45848.1 protein network | https://string-db.org/network/866895.HBHAL_3504 | Homolog to ATP-dependent RNA helicase. |
| yqhG protein network | https://string-db.org/network/866895.HBHAL_3505 | Hypothetical protein. |
| CCG45850.1 protein network | https://string-db.org/network/866895.HBHAL_3506 | Hypothetical protein. |
| aroK protein network | https://string-db.org/network/866895.HBHAL_3507 | Shikimate kinase; Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate; Belongs to the shikimate kinase family. |
| comGA protein network | https://string-db.org/network/866895.HBHAL_3508 | ComG operon protein 1. |
| CCG45853.1 protein network | https://string-db.org/network/866895.HBHAL_3509 | Conserved hypothetical protein. |
| comGC protein network | https://string-db.org/network/866895.HBHAL_3510 | ComG operon protein 3; Required for transformation and DNA binding. |
| comGD protein network | https://string-db.org/network/866895.HBHAL_3510_A | ComG operon protein 4. |
| CCG45856.1 protein network | https://string-db.org/network/866895.HBHAL_3511 | Hypothetical protein. |
| CCG45857.1 protein network | https://string-db.org/network/866895.HBHAL_3512 | Hypothetical protein. |
| mgsR protein network | https://string-db.org/network/866895.HBHAL_3513 | Stress response modulator MgsR; Belongs to the ArsC family. |
| yqgY protein network | https://string-db.org/network/866895.HBHAL_3514 | Conserved hypothetical protein. |
| yqgX protein network | https://string-db.org/network/866895.HBHAL_3515 | Metallo-beta-lactamase family protein. |
| CCG45861.1 protein network | https://string-db.org/network/866895.HBHAL_3516 | Probable ABC-type transport system permease protein. |
| CCG45862.1 protein network | https://string-db.org/network/866895.HBHAL_3517 | ABC-type transport system ATP-binding protein; Belongs to the ABC transporter superfamily. |
| yqgS3 protein network | https://string-db.org/network/866895.HBHAL_3518 | YqgS family protein; Belongs to the LTA synthase family. |
| CCG45864.1 protein network | https://string-db.org/network/866895.HBHAL_3519 | ROK family protein. |
| CCG45865.1 protein network | https://string-db.org/network/866895.HBHAL_3520 | Hypothetical protein. |
| CCG45866.1 protein network | https://string-db.org/network/866895.HBHAL_3521 | Stage V sporulation protein AF. |
| CCG45867.1 protein network | https://string-db.org/network/866895.HBHAL_3522 | Hypothetical protein. |
| yqgP protein network | https://string-db.org/network/866895.HBHAL_3523 | S54 family peptidase. |
| ldh1 protein network | https://string-db.org/network/866895.HBHAL_3524 | L-lactate dehydrogenase; Catalyzes the conversion of lactate to pyruvate. Belongs to the LDH/MDH superfamily. LDH family. |
| CCG45870.1 protein network | https://string-db.org/network/866895.HBHAL_3525 | 5-formyltetrahydrofolate cyclo-ligase family protein; Belongs to the 5-formyltetrahydrofolate cyclo-ligase family. |
| CCG45871.1 protein network | https://string-db.org/network/866895.HBHAL_3526 | Hypothetical protein. |
| rpmG2 protein network | https://string-db.org/network/866895.HBHAL_3526_A | 50S ribosomal protein L33; Belongs to the bacterial ribosomal protein bL33 family. |
| CCG45873.1 protein network | https://string-db.org/network/866895.HBHAL_3527 | Hypothetical protein. |
| CCG45874.1 protein network | https://string-db.org/network/866895.HBHAL_3528 | Phosphate transport system regulatory protein; Plays a role in the regulation of phosphate uptake. |
| pstB protein network | https://string-db.org/network/866895.HBHAL_3529 | ABC-type transport system ATP-binding protein (probable substrate phosphate); Part of the ABC transporter complex PstSACB involved in phosphate import. Responsible for energy coupling to the tran [...] |
| CCG45876.1 protein network | https://string-db.org/network/866895.HBHAL_3530 | ABC-type transport system permease protein (probable substrate phosphate). |
| CCG45877.1 protein network | https://string-db.org/network/866895.HBHAL_3531 | ABC-type transport system permease protein (probables substrate phosphate); Part of the binding-protein-dependent transport system for phosphate; probably responsible for the translocation of the [...] |
| CCG45878.1 protein network | https://string-db.org/network/866895.HBHAL_3532 | ABC-type transport system extracellular binding protein (probable substrate phosphate). |
| pbpA protein network | https://string-db.org/network/866895.HBHAL_3533 | Penicillin-binding protein. |
| CCG45880.1 protein network | https://string-db.org/network/866895.HBHAL_3534 | Putative MFS-type transporter. |
| sodA protein network | https://string-db.org/network/866895.HBHAL_3535 | Superoxide dismutase (Mn); Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Belongs to the iron/manganese superoxide dismutase family. |
| CCG45883.1 protein network | https://string-db.org/network/866895.HBHAL_3537 | Hypothetical protein. |
| ispG protein network | https://string-db.org/network/866895.HBHAL_3538 | 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Converts 2C-methyl-D-erythritol 2,4-cyclodiphosphate (ME- 2,4cPP) into 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate. Belongs to the IspG fa [...] |
| CCG45885.1 protein network | https://string-db.org/network/866895.HBHAL_3539 | Hypothetical protein. |
| CCG45886.1 protein network | https://string-db.org/network/866895.HBHAL_3540 | Hypothetical protein. |
| nfo protein network | https://string-db.org/network/866895.HBHAL_3541 | Endonuclease IV; Endonuclease IV plays a role in DNA repair. It cleaves phosphodiester bonds at apurinic or apyrimidinic sites (AP sites) to produce new 5'-ends that are base-free deoxyribose 5-p [...] |
| cshB protein network | https://string-db.org/network/866895.HBHAL_3542 | DEAD-box ATP-dependent RNA helicase CshB. |
| ispH protein network | https://string-db.org/network/866895.HBHAL_3543 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Catalyzes the conversion of 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate (HMBPP) into a mixture of isopentenyl diphosphate (IPP) and dimethyl [...] |
| yqfO protein network | https://string-db.org/network/866895.HBHAL_3544 | Conserved hypothetical protein; Belongs to the GTP cyclohydrolase I type 2/NIF3 family. |
| yqfN protein network | https://string-db.org/network/866895.HBHAL_3545 | Conserved hypothetical protein. |
| cccA protein network | https://string-db.org/network/866895.HBHAL_3546 | Cytochrome c-550. |
| sigA protein network | https://string-db.org/network/866895.HBHAL_3547 | RNA polymerase sigma factor SigA; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is the p [...] |
| dnaG protein network | https://string-db.org/network/866895.HBHAL_3548 | DNA primase; RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. |
| yqxD protein network | https://string-db.org/network/866895.HBHAL_3549 | Conserved hypothetical protein; Belongs to the UPF0178 family. |
| yqfL1 protein network | https://string-db.org/network/866895.HBHAL_3550 | Probable phosphotransferase YqfL; Bifunctional serine/threonine kinase and phosphorylase involved in the regulation of the pyruvate, phosphate dikinase (PPDK) by catalyzing its phosphorylation/de [...] |
| yqzB protein network | https://string-db.org/network/866895.HBHAL_3551 | Hypothetical protein. |
| glyS protein network | https://string-db.org/network/866895.HBHAL_3552 | glycyl-tRNA synthetase beta subunit. |
| glyQ protein network | https://string-db.org/network/866895.HBHAL_3553 | glycyl-tRNA synthetase alpha subunit. |
| CCG45900.1 protein network | https://string-db.org/network/866895.HBHAL_3554 | Hypothetical protein. |
| recO protein network | https://string-db.org/network/866895.HBHAL_3555 | DNA repair protein RecO; Involved in DNA repair and RecF pathway recombination. |
| CCG45902.1 protein network | https://string-db.org/network/866895.HBHAL_3556 | Hypothetical protein. |
| CCG45903.1 protein network | https://string-db.org/network/866895.HBHAL_3557 | Hypothetical protein. |
| era protein network | https://string-db.org/network/866895.HBHAL_3558 | GTP-binding protein Era; An essential GTPase that binds both GDP and GTP, with rapid nucleotide exchange. Plays a role in 16S rRNA processing and 30S ribosomal subunit biogenesis and possibly als [...] |
| dgkA protein network | https://string-db.org/network/866895.HBHAL_3559 | Diacylglycerol kinase. |
| ybeY protein network | https://string-db.org/network/866895.HBHAL_3560 | Probable rRNA maturation factor; Single strand-specific metallo-endoribonuclease involved in late-stage 70S ribosome quality control and in maturation of the 3' terminus of the 16S rRNA. |
| phoH protein network | https://string-db.org/network/866895.HBHAL_3561 | PhoH protein. |
| CCG45908.1 protein network | https://string-db.org/network/866895.HBHAL_3562 | Similar to stage IV sporulation protein. |
| CCG45909.1 protein network | https://string-db.org/network/866895.HBHAL_3563 | Conserved hypothetical protein. |
| CCG45910.1 protein network | https://string-db.org/network/866895.HBHAL_3564 | Hypothetical protein. |
| yqfA protein network | https://string-db.org/network/866895.HBHAL_3565 | UPF0365 family protein. |
| CCG45912.1 protein network | https://string-db.org/network/866895.HBHAL_3566 | Conserved hypothetical protein. |
| yqeY protein network | https://string-db.org/network/866895.HBHAL_3567 | Conserved hypothetical protein. |
| rpsU protein network | https://string-db.org/network/866895.HBHAL_3568 | 30S ribosomal protein S21; Belongs to the bacterial ribosomal protein bS21 family. |
| deoC protein network | https://string-db.org/network/866895.HBHAL_3569 | Deoxyribose-phosphate aldolase; Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5- phosphate; Belongs to the DeoC/FbaB ald [...] |
| CCG45916.1 protein network | https://string-db.org/network/866895.HBHAL_3570 | Conserved hypothetical protein; Specifically methylates the N3 position of the uracil ring of uridine 1498 (m3U1498) in 16S rRNA. Acts on the fully assembled 30S ribosomal subunit. |
| prmA protein network | https://string-db.org/network/866895.HBHAL_3571 | Ribosomal protein L11 methyltransferase; Methylates ribosomal protein L11; Belongs to the methyltransferase superfamily. PrmA family. |
| dnaJ protein network | https://string-db.org/network/866895.HBHAL_3572 | Chaperone protein DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an [...] |
| dnaK protein network | https://string-db.org/network/866895.HBHAL_3573 | Molecular chaperone DnaK; Acts as a chaperone; Belongs to the heat shock protein 70 family. |
| grpE protein network | https://string-db.org/network/866895.HBHAL_3574 | GrpE protein; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleot [...] |
| hrcA protein network | https://string-db.org/network/866895.HBHAL_3575 | Heat-inducible transcription repressor HrcA; Negative regulator of class I heat shock genes (grpE-dnaK- dnaJ and groELS operons). Prevents heat-shock induction of these operons. |
| hemN protein network | https://string-db.org/network/866895.HBHAL_3576 | Coproporphyrinogen III oxidase; Probably acts as a heme chaperone, transferring heme to an unknown acceptor. Binds one molecule of heme per monomer, possibly covalently. Binds 1 [4Fe-4S] cluster. [...] |
| lepA protein network | https://string-db.org/network/866895.HBHAL_3577 | GTP-binding protein; Required for accurate and efficient protein synthesis under certain stress conditions. May act as a fidelity factor of the translation reaction, by catalyzing a one-codon bac [...] |
| CCG45924.1 protein network | https://string-db.org/network/866895.HBHAL_3578 | Hypothetical protein. |
| CCG45925.1 protein network | https://string-db.org/network/866895.HBHAL_3579 | Stage II sporulation protein P. |
| gpr protein network | https://string-db.org/network/866895.HBHAL_3580 | Germination proteinase; Initiates the rapid degradation of small, acid-soluble proteins during spore germination; Belongs to the peptidase A25 family. |
| rpsT protein network | https://string-db.org/network/866895.HBHAL_3581 | 30S ribosomal protein S20; Binds directly to 16S ribosomal RNA. |
| holA protein network | https://string-db.org/network/866895.HBHAL_3582 | DNA polymerase III delta subunit. |
| CCG45929.1 protein network | https://string-db.org/network/866895.HBHAL_3583 | Hypothetical protein. |
| comEC protein network | https://string-db.org/network/866895.HBHAL_3584 | Competence protein ComEC. |
| comEB protein network | https://string-db.org/network/866895.HBHAL_3585 | ComE operon protein 2. |
| comEA protein network | https://string-db.org/network/866895.HBHAL_3586 | Competence protein ComEA. |
| comER protein network | https://string-db.org/network/866895.HBHAL_3587 | ComE operon protein 4; Catalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline. |
| CCG45934.1 protein network | https://string-db.org/network/866895.HBHAL_3588 | Conserved hypothetical protein. |
| rsfS protein network | https://string-db.org/network/866895.HBHAL_3589 | Conserved hypothetical protein; Functions as a ribosomal silencing factor. Interacts with ribosomal protein L14 (rplN), blocking formation of intersubunit bridge B8. Prevents association of the 3 [...] |
| yqeK protein network | https://string-db.org/network/866895.HBHAL_3590 | Hypothetical protein. |
| nadD protein network | https://string-db.org/network/866895.HBHAL_3591 | Nicotinic acid mononucleotide adenyltransferase; Catalyzes the reversible adenylation of nicotinate mononucleotide (NaMN) to nicotinic acid adenine dinucleotide (NaAD). |
| yqeI protein network | https://string-db.org/network/866895.HBHAL_3592 | Probable RNA-binding protein YqeI. |
| aroE protein network | https://string-db.org/network/866895.HBHAL_3593 | Shikimate 5-dehydrogenase; Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshi [...] |
| CCG45940.1 protein network | https://string-db.org/network/866895.HBHAL_3594 | GTPase familiy protein. |
| yqeG protein network | https://string-db.org/network/866895.HBHAL_3595 | HAD superfamily hydrolase. |
| CCG45942.1 protein network | https://string-db.org/network/866895.HBHAL_3596 | Hypothetical protein. |
| CCG45943.1 protein network | https://string-db.org/network/866895.HBHAL_3597 | Monovalent cation/H+ antiporter subunit A. |
| CCG45944.1 protein network | https://string-db.org/network/866895.HBHAL_3598 | Monovalent cation/H+ antiporter subunit C. |
| CCG45945.1 protein network | https://string-db.org/network/866895.HBHAL_3599 | Monovalent cation/H+ antiporter subunit D. |
| CCG45946.1 protein network | https://string-db.org/network/866895.HBHAL_3600 | Monovalent cation/H+ antiporter subunit E. |
| CCG45947.1 protein network | https://string-db.org/network/866895.HBHAL_3601 | Monovalent cation/H+ antiporter subunit F. |
| CCG45948.1 protein network | https://string-db.org/network/866895.HBHAL_3602 | Monovalent cation/H+ antiporter subunit G. |
| sigK protein network | https://string-db.org/network/866895.HBHAL_3603 | RNA polymerase sigma factor SigK; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. |
| CCG45950.1 protein network | https://string-db.org/network/866895.HBHAL_3604 | Hypothetical protein. |
| mtnN1 protein network | https://string-db.org/network/866895.HBHAL_3605 | 5'-methylthioadenosine/ S-adenosylhomocysteinenucleosidase; Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) [...] |
| CCG45952.1 protein network | https://string-db.org/network/866895.HBHAL_3606 | Conserved hypothetical protein. |
| greA protein network | https://string-db.org/network/866895.HBHAL_3607 | Transcription elongation factor GreA; Necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trappi [...] |
| udk protein network | https://string-db.org/network/866895.HBHAL_3608 | Uridine kinase. |
| yrrM protein network | https://string-db.org/network/866895.HBHAL_3609 | Probable O-methyltransferase YrrM. |
| mltG protein network | https://string-db.org/network/866895.HBHAL_3610 | UPF0755 family protein; Functions as a peptidoglycan terminase that cleaves nascent peptidoglycan strands endolytically to terminate their elongation. Belongs to the transglycosylase MltG family. |
| CCG45957.1 protein network | https://string-db.org/network/866895.HBHAL_3611 | UPF0473 family protein; Belongs to the UPF0473 family. |
| yrrK protein network | https://string-db.org/network/866895.HBHAL_3612 | Probable Holliday junction resolvase; Could be a nuclease involved in processing of the 5'-end of pre-16S rRNA; Belongs to the YqgF HJR family. |
| yrzL protein network | https://string-db.org/network/866895.HBHAL_3613 | Hypothetical protein; Belongs to the UPF0297 family. |
| alaS protein network | https://string-db.org/network/866895.HBHAL_3614 | alanyl-tRNA synthetase; Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRN [...] |
| CCG45961.1 protein network | https://string-db.org/network/866895.HBHAL_3615 | UPF0118 family protein. |
| CCG45962.1 protein network | https://string-db.org/network/866895.HBHAL_3616 | Hypothetical protein. |
| recD protein network | https://string-db.org/network/866895.HBHAL_3617 | Exodeoxyribonuclease V alpha subunit; DNA-dependent ATPase and ATP-dependent 5'-3' DNA helicase. Has no activity on blunt DNA or DNA with 3'-overhangs, requires at least 10 bases of 5'-ssDNA for [...] |
| CCG45964.1 protein network | https://string-db.org/network/866895.HBHAL_3618 | TPR domain protein. |
| mnmA protein network | https://string-db.org/network/866895.HBHAL_3620 | tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase; Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34. |
| CCG45966.1 protein network | https://string-db.org/network/866895.HBHAL_3621 | Aminotransferase. |
| cymR protein network | https://string-db.org/network/866895.HBHAL_3622 | Transcription regulator CymR. |
| yyaS6 protein network | https://string-db.org/network/866895.HBHAL_3623 | Conserved hypothetical protein. |
| CCG45969.1 protein network | https://string-db.org/network/866895.HBHAL_3624 | ATPase, AAA family. |
| rsfA protein network | https://string-db.org/network/866895.HBHAL_3625 | Prespore-specific transcription regulator RsfA. |
| aspS protein network | https://string-db.org/network/866895.HBHAL_3626 | aspartyl-tRNA synthetase; Catalyzes the attachment of L-aspartate to tRNA(Asp) in a two-step reaction: L-aspartate is first activated by ATP to form Asp- AMP and then transferred to the acceptor [...] |
| hisS protein network | https://string-db.org/network/866895.HBHAL_3627 | histidyl-tRNA synthetase. |
| CCG45973.1 protein network | https://string-db.org/network/866895.HBHAL_3628 | Hypothetical protein. |
| CCG45974.1 protein network | https://string-db.org/network/866895.HBHAL_3629 | Putative N-acetylmuramoyl-L-alanine amidase. |
| yrvI protein network | https://string-db.org/network/866895.HBHAL_3630 | D-tyrosyl-tRNA deacylase; An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging [...] |
| relA protein network | https://string-db.org/network/866895.HBHAL_3631 | GTP pyrophosphokinase; In eubacteria ppGpp (guanosine 3'-diphosphate 5-' diphosphate) is a mediator of the stringent response that coordinates a variety of cellular activities in response to chan [...] |
| apt protein network | https://string-db.org/network/866895.HBHAL_3632 | Adenine phosphoribosyltransferase; Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. |
| recJ protein network | https://string-db.org/network/866895.HBHAL_3633 | single-stranded-DNA-specific exonuclease RecJ. |
| CCG45979.1 protein network | https://string-db.org/network/866895.HBHAL_3634 | Hypothetical protein. |
| secF protein network | https://string-db.org/network/866895.HBHAL_3635 | Protein-export membrane protein SecDF; Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. SecDF uses the proton motive force (PMF) to complete p [...] |
| CCG45981.1 protein network | https://string-db.org/network/866895.HBHAL_3636 | Stage V sporulation protein B. |
| yrbG protein network | https://string-db.org/network/866895.HBHAL_3637 | Hypothetical protein. |
| CCG45983.1 protein network | https://string-db.org/network/866895.HBHAL_3638 | Putative arsenical pump membrane protein. |
| CCG45984.1 protein network | https://string-db.org/network/866895.HBHAL_3639 | Hypothetical protein. |
| yajC protein network | https://string-db.org/network/866895.HBHAL_3640 | Preprotein translocase subunit YajC. |
| tgt protein network | https://string-db.org/network/866895.HBHAL_3641 | Queuine tRNA-ribosyltransferase; Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in [...] |
| queA protein network | https://string-db.org/network/866895.HBHAL_3642 | S-adenosylmethionine:tRNAribosyltransferase- isomerase; Transfers and isomerizes the ribose moiety from AdoMet to the 7-aminomethyl group of 7-deazaguanine (preQ1-tRNA) to give epoxyqueuosine (oQ [...] |
| CCG45988.1 protein network | https://string-db.org/network/866895.HBHAL_3643 | Hypothetical protein. |
| ruvB protein network | https://string-db.org/network/866895.HBHAL_3644 | Holliday junction ATP-dependent DNA helicase RuvB; The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may [...] |
| ruvA protein network | https://string-db.org/network/866895.HBHAL_3645 | Holliday junction ATP-dependent DNA helicase RuvA; The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may [...] |
| CCG45991.1 protein network | https://string-db.org/network/866895.HBHAL_3646 | Bypass-of-forespore protein C, putative. |
| CCG45992.1 protein network | https://string-db.org/network/866895.HBHAL_3647 | UPF0082 family protein. |
| CCG45993.1 protein network | https://string-db.org/network/866895.HBHAL_3648 | Hypothetical protein. |
| nadE2 protein network | https://string-db.org/network/866895.HBHAL_3649 | NH3-dependent NAD+ synthetase; Catalyzes the ATP-dependent amidation of deamido-NAD to form NAD. Uses ammonia as a nitrogen source; Belongs to the NAD synthetase family. |
| CCG45995.1 protein network | https://string-db.org/network/866895.HBHAL_3650 | Hypothetical protein. |
| CCG45996.1 protein network | https://string-db.org/network/866895.HBHAL_3651 | Conserved hypothetical protein. |
| pheA protein network | https://string-db.org/network/866895.HBHAL_3652 | Prephenate dehydratase. |
| yszB protein network | https://string-db.org/network/866895.HBHAL_3653 | UPF0735 family protein; Belongs to the UPF0735 family. |
| obg protein network | https://string-db.org/network/866895.HBHAL_3654 | GTPase Obg; An essential GTPase which binds GTP, GDP and possibly (p)ppGpp with moderate affinity, with high nucleotide exchange rates and a fairly low GTP hydrolysis rate. Plays a role in contro [...] |
| CCG46000.1 protein network | https://string-db.org/network/866895.HBHAL_3655 | Putative sporulation initiation phosphotransferase. |
| rpmA protein network | https://string-db.org/network/866895.HBHAL_3656 | 50S ribosomal protein L27; Belongs to the bacterial ribosomal protein bL27 family. |
| CCG46002.1 protein network | https://string-db.org/network/866895.HBHAL_3657 | Conserved hypothetical protein. |
| rplU protein network | https://string-db.org/network/866895.HBHAL_3658 | 50S ribosomal protein L21; This protein binds to 23S rRNA in the presence of protein L20; Belongs to the bacterial ribosomal protein bL21 family. |
| CCG46004.1 protein network | https://string-db.org/network/866895.HBHAL_3659 | Ribonuclease, Rne/Rng family. |
| CCG46005.1 protein network | https://string-db.org/network/866895.HBHAL_3660 | Stage IV sporulation protein FB. |
| CCG46006.1 protein network | https://string-db.org/network/866895.HBHAL_3661 | Stage IV sporulation protein FA. |
| minD protein network | https://string-db.org/network/866895.HBHAL_3662 | Septum site-determining protein MinD. |
| minC protein network | https://string-db.org/network/866895.HBHAL_3663 | Septum formation inhibitor; Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have for [...] |
| mreD protein network | https://string-db.org/network/866895.HBHAL_3664 | Cell-shape determining protein. |
| mreC protein network | https://string-db.org/network/866895.HBHAL_3665 | Rod shape-determining protein MreC; Involved in formation and maintenance of cell shape. |
| mreB1 protein network | https://string-db.org/network/866895.HBHAL_3666 | Rod shape-determining protein MreB. |
| radC protein network | https://string-db.org/network/866895.HBHAL_3667 | DNA repair protein RadC; Belongs to the UPF0758 family. |
| maf protein network | https://string-db.org/network/866895.HBHAL_3668 | Maf-like protein; Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides in [...] |
| CCG46014.1 protein network | https://string-db.org/network/866895.HBHAL_3669 | Conserved hypothetical protein. |
| comC protein network | https://string-db.org/network/866895.HBHAL_3670 | ComC. |
| CCG46016.1 protein network | https://string-db.org/network/866895.HBHAL_3671 | Diguanylate cyclase domain protein. |
| CCG46017.1 protein network | https://string-db.org/network/866895.HBHAL_3672 | Folylpolyglutamate synthase; Belongs to the folylpolyglutamate synthase family. |
| valS protein network | https://string-db.org/network/866895.HBHAL_3673 | valyl-tRNA synthetase; Catalyzes the attachment of valine to tRNA(Val). As ValRS can inadvertently accommodate and process structurally similar amino acids such as threonine, to avoid such errors [...] |
| CCG46019.1 protein network | https://string-db.org/network/866895.HBHAL_3674 | Hypothetical protein. |
| CCG46020.1 protein network | https://string-db.org/network/866895.HBHAL_3675 | Stage VI sporulation protein D. |
| hemL-3 protein network | https://string-db.org/network/866895.HBHAL_3676 | Glutamate-1-semialdehyde aminotransferase. |
| hemB protein network | https://string-db.org/network/866895.HBHAL_3677 | Delta-aminolevulinic acid dehydratase; Belongs to the ALAD family. |
| hemD protein network | https://string-db.org/network/866895.HBHAL_3678 | uroporphyrinogen-III synthase; Catalyzes cyclization of the linear tetrapyrrole, hydroxymethylbilane, to the macrocyclic uroporphyrinogen III. |
| hemC protein network | https://string-db.org/network/866895.HBHAL_3679 | Porphobilinogen deaminase; Tetrapolymerization of the monopyrrole PBG into the hydroxymethylbilane pre-uroporphyrinogen in several discrete steps. Belongs to the HMBS family. |
| hemX protein network | https://string-db.org/network/866895.HBHAL_3680 | HemX protein. |
| hemA protein network | https://string-db.org/network/866895.HBHAL_3681 | glutamyl-tRNA reductase; Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA). |
| CCG46027.1 protein network | https://string-db.org/network/866895.HBHAL_3681_A | Conserved hypothetical protein. |
| CCG46028.1 protein network | https://string-db.org/network/866895.HBHAL_3682 | ABC-type transport system ATP-binding protein (probable substrate polar amino acid). |
| CCG46029.1 protein network | https://string-db.org/network/866895.HBHAL_3683 | ABC-type transport system permease protein (probable substrate polar amino acid). |
| CCG46030.1 protein network | https://string-db.org/network/866895.HBHAL_3684 | ABC-type transport system extracellular binding protein (probable substrate polar amino acid); Belongs to the bacterial solute-binding protein 3 family. |
| engB protein network | https://string-db.org/network/866895.HBHAL_3685 | GTPase EngB; Necessary for normal cell division and for the maintenance of normal septation; Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. EngB GTPase family. |
| lon protein network | https://string-db.org/network/866895.HBHAL_3686 | ATP-dependent protease La; ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short- lived regulatory proteins. Required for [...] |
| clpX protein network | https://string-db.org/network/866895.HBHAL_3687 | ATP-dependent Clp protease ATP-binding subunit; ATP-dependent specificity component of the Clp protease. It directs the protease to specific substrates. Can perform chaperone functions in the abs [...] |
| tig protein network | https://string-db.org/network/866895.HBHAL_3688 | Trigger factor; Involved in protein export. Acts as a chaperone by maintaining the newly synthesized protein in an open conformation. Functions as a peptidyl-prolyl cis-trans isomerase; Belongs t [...] |
| ysoA protein network | https://string-db.org/network/866895.HBHAL_3689 | Hypothetical protein. |
| CCG46037.1 protein network | https://string-db.org/network/866895.HBHAL_3692 | IS150-type transposase orfAB. |
| CCG46038.1 protein network | https://string-db.org/network/866895.HBHAL_3693 | Hypothetical protein. |
| qoxD protein network | https://string-db.org/network/866895.HBHAL_3694 | Cytochrome aa3 quinol oxidase subunit IV. |
| qoxC protein network | https://string-db.org/network/866895.HBHAL_3695 | Cytochrome aa3 quinol oxidase subunit III. |
| qoxB protein network | https://string-db.org/network/866895.HBHAL_3696 | Cytochrome aa3 quinol oxidase subunit I. |
| qoxA protein network | https://string-db.org/network/866895.HBHAL_3697 | Cytochrome aa3 quinol oxidase subunit II; Catalyzes quinol oxidation with the concomitant reduction of oxygen to water. Subunit II transfers the electrons from a quinol to the binuclear center of [...] |
| CCG46043.1 protein network | https://string-db.org/network/866895.HBHAL_3698 | Hypothetical protein. |
| ywaD protein network | https://string-db.org/network/866895.HBHAL_3699 | Aminopeptidase. |
| CCG46045.1 protein network | https://string-db.org/network/866895.HBHAL_3700 | Putative phosphodiesterase. |
| CCG46046.1 protein network | https://string-db.org/network/866895.HBHAL_3701 | Putative nucleoside-triphosphatase; Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical puri [...] |
| rph protein network | https://string-db.org/network/866895.HBHAL_3702 | Ribonuclease PH; Phosphorolytic 3'-5' exoribonuclease that plays an important role in tRNA 3'-end maturation. Removes nucleotide residues following the 3'-CCA terminus of tRNAs; can also add nucl [...] |
| gerM protein network | https://string-db.org/network/866895.HBHAL_3703 | Spore germination protein GerM. |
| racE protein network | https://string-db.org/network/866895.HBHAL_3704 | Glutamate racemase; Provides the (R)-glutamate required for cell wall biosynthesis. |
| ysmB protein network | https://string-db.org/network/866895.HBHAL_3705 | MarR family transcription regulator. |
| CCG46051.1 protein network | https://string-db.org/network/866895.HBHAL_3706 | LuxR family transcription regulator. |
| CCG46052.1 protein network | https://string-db.org/network/866895.HBHAL_3707 | Two-component response regulator. |
| CCG46053.1 protein network | https://string-db.org/network/866895.HBHAL_3708 | Two-component sensor histidine kinase. |
| CCG46054.1 protein network | https://string-db.org/network/866895.HBHAL_3709 | Homolog to comP protein N-terminal domain. |
| sdhB protein network | https://string-db.org/network/866895.HBHAL_3710 | Succinate dehydrogenase iron-sulfur subunit. |
| sdhA protein network | https://string-db.org/network/866895.HBHAL_3711 | Succinate dehydrogenase flavoprotein subunit. |
| sdhC protein network | https://string-db.org/network/866895.HBHAL_3712 | Succinate dehydrogenase cytochrome b558 subunit. |
| CCG46058.1 protein network | https://string-db.org/network/866895.HBHAL_3713 | Conserved hypothetical protein. |
| uvrC protein network | https://string-db.org/network/866895.HBHAL_3714 | Excinuclease ABC subunit C; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsib [...] |
| trxA1 protein network | https://string-db.org/network/866895.HBHAL_3715 | Thioredoxin; Belongs to the thioredoxin family. |
| etfA protein network | https://string-db.org/network/866895.HBHAL_3716 | Electron transfer flavoprotein alpha subunit. |
| etfB protein network | https://string-db.org/network/866895.HBHAL_3717 | Electron transfer flavoprotein beta subunit. |
| CCG46063.1 protein network | https://string-db.org/network/866895.HBHAL_3718 | enoyl-CoA hydratase; Belongs to the enoyl-CoA hydratase/isomerase family. |
| fadR protein network | https://string-db.org/network/866895.HBHAL_3719 | TetR family transcription regulator. |
| lcfA protein network | https://string-db.org/network/866895.HBHAL_3720 | long-chain-fatty-acid--CoA ligase. |
| yshE1 protein network | https://string-db.org/network/866895.HBHAL_3721 | UPF0719 family protein. |
| mutS2 protein network | https://string-db.org/network/866895.HBHAL_3722 | DNA mismatch repair protein MutS; Endonuclease that is involved in the suppression of homologous recombination and may therefore have a key role in the control of bacterial genetic diversity; Bel [...] |
| polX protein network | https://string-db.org/network/866895.HBHAL_3723 | DNA polymerase PolX. |
| yshB protein network | https://string-db.org/network/866895.HBHAL_3725 | Conserved hypothetical protein. |
| CCG46071.1 protein network | https://string-db.org/network/866895.HBHAL_3726 | Conserved hypothetical protein; Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the forma [...] |
| rnhC protein network | https://string-db.org/network/866895.HBHAL_3727 | Ribonuclease HIII; Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. |
| pheT protein network | https://string-db.org/network/866895.HBHAL_3728 | phenylalanyl-tRNA synthetase beta subunit; Belongs to the phenylalanyl-tRNA synthetase beta subunit family. Type 1 subfamily. |
| pheS protein network | https://string-db.org/network/866895.HBHAL_3729 | phenylalanyl-tRNA synthetase alpha subunit; Belongs to the class-II aminoacyl-tRNA synthetase family. Phe-tRNA synthetase alpha subunit type 1 subfamily. |
| CCG46075.1 protein network | https://string-db.org/network/866895.HBHAL_3730 | RNA methyltransferase; Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family. |
| sspI protein network | https://string-db.org/network/866895.HBHAL_3731 | Small acid-soluble spore protein; Belongs to the SspI family. |
| yhfE protein network | https://string-db.org/network/866895.HBHAL_3732 | M42 family peptidase. |
| CCG46078.1 protein network | https://string-db.org/network/866895.HBHAL_3733 | Hypothetical protein. |
| ysdB protein network | https://string-db.org/network/866895.HBHAL_3734 | Hypothetical protein. |
| CCG46081.1 protein network | https://string-db.org/network/866895.HBHAL_3736 | DedA family protein. |
| CCG46082.1 protein network | https://string-db.org/network/866895.HBHAL_3737 | Hypothetical protein. |
| rplT protein network | https://string-db.org/network/866895.HBHAL_3738 | 50S ribosomal protein L20; Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing func [...] |
| rpmI protein network | https://string-db.org/network/866895.HBHAL_3739 | 50S ribosomal protein L35; Belongs to the bacterial ribosomal protein bL35 family. |
| infC protein network | https://string-db.org/network/866895.HBHAL_3740 | Translation initiation factor IF-3; IF-3 binds to the 30S ribosomal subunit and shifts the equilibrum between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits, thus enha [...] |
| thrS protein network | https://string-db.org/network/866895.HBHAL_3741 | threonyl-tRNA synthetase; Catalyzes the attachment of threonine to tRNA(Thr) in a two- step reaction: L-threonine is first activated by ATP to form Thr-AMP and then transferred to the acceptor en [...] |
| CCG46087.1 protein network | https://string-db.org/network/866895.HBHAL_3742 | Hypothetical protein. |
| CCG46088.1 protein network | https://string-db.org/network/866895.HBHAL_3743 | Conserved hypothetical protein. |
| dnaI protein network | https://string-db.org/network/866895.HBHAL_3744 | Primosomal protein DnaI. |
| dnaB protein network | https://string-db.org/network/866895.HBHAL_3745 | DNA replication protein DnaB. |
| nrdR protein network | https://string-db.org/network/866895.HBHAL_3746 | Transcription regulator NrdR; Negatively regulates transcription of bacterial ribonucleotide reductase nrd genes and operons by binding to NrdR- boxes; Belongs to the NrdR family. |
| CCG46092.1 protein network | https://string-db.org/network/866895.HBHAL_3747 | Hypothetical protein. |
| speH protein network | https://string-db.org/network/866895.HBHAL_3748 | S-adenosylmethionine decarboxylase; Catalyzes the decarboxylation of S-adenosylmethionine to S- adenosylmethioninamine (dcAdoMet), the propylamine donor required for the synthesis of the polyamin [...] |
| gapB protein network | https://string-db.org/network/866895.HBHAL_3749 | Glyceraldehyde-3-phosphate dehydrogenase; Belongs to the glyceraldehyde-3-phosphate dehydrogenase family. |
| coaE protein network | https://string-db.org/network/866895.HBHAL_3750 | dephospho-CoA kinase; Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A; Belongs to the CoaE family. |
| CCG46096.1 protein network | https://string-db.org/network/866895.HBHAL_3751 | Conserved hypothetical protein; Probably functions as a manganese efflux pump. |
| mutM protein network | https://string-db.org/network/866895.HBHAL_3752 | formamidopyrimidine-DNA glycosylase; Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a [...] |
| polA protein network | https://string-db.org/network/866895.HBHAL_3753 | DNA polymerase I; In addition to polymerase activity, this DNA polymerase exhibits 5'-3' exonuclease activity. |
| CCG46099.1 protein network | https://string-db.org/network/866895.HBHAL_3754 | Two-component sensor histidine kinase. |
| CCG46100.1 protein network | https://string-db.org/network/866895.HBHAL_3755 | Two-component response regulator. |
| CCG46101.1 protein network | https://string-db.org/network/866895.HBHAL_3756 | MaoC family protein. |
| mdh protein network | https://string-db.org/network/866895.HBHAL_3757 | Malate dehydrogenase; Catalyzes the reversible oxidation of malate to oxaloacetate. Belongs to the LDH/MDH superfamily. MDH type 3 family. |
| citC protein network | https://string-db.org/network/866895.HBHAL_3758 | Isocitrate dehydrogenase. |
| citZ protein network | https://string-db.org/network/866895.HBHAL_3759 | Methylcitrate synthase; Belongs to the citrate synthase family. |
| CCG46105.1 protein network | https://string-db.org/network/866895.HBHAL_3760 | UPF0118 family protein. |
| fxsA protein network | https://string-db.org/network/866895.HBHAL_3761 | FxsA protein. |
| pykA protein network | https://string-db.org/network/866895.HBHAL_3762 | Pyruvate kinase; Belongs to the pyruvate kinase family. |
| pfkA2 protein network | https://string-db.org/network/866895.HBHAL_3763 | 6-phosphofructokinase; Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis. |
| accA protein network | https://string-db.org/network/866895.HBHAL_3764 | acetyl-CoA carboxylase carboxyltransferase subunit alpha; Component of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carr [...] |
| accD protein network | https://string-db.org/network/866895.HBHAL_3765 | acetyl-CoA carboxylase carboxyltransferase subunit beta; Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier [...] |
| CCG46111.1 protein network | https://string-db.org/network/866895.HBHAL_3766 | GntR family transcription regulator. |
| CCG46112.1 protein network | https://string-db.org/network/866895.HBHAL_3767 | Malate dehydrogenase (oxaloacetate-decarboxylating). |
| dnaE protein network | https://string-db.org/network/866895.HBHAL_3768 | DNA polymerase III alpha subunit. |
| ytrH protein network | https://string-db.org/network/866895.HBHAL_3769 | Hypothetical protein. |
| ytrI protein network | https://string-db.org/network/866895.HBHAL_3770 | Hypothetical protein. |
| ytqI protein network | https://string-db.org/network/866895.HBHAL_3771 | DHH family phosphoesterase. |
| CCG46117.1 protein network | https://string-db.org/network/866895.HBHAL_3772 | Hypothetical protein. |
| CCG46118.1 protein network | https://string-db.org/network/866895.HBHAL_3773 | Thioesterase family protein. |
| ytkL protein network | https://string-db.org/network/866895.HBHAL_3774 | Metal-dependent hydrolase; Belongs to the UPF0173 family. |
| speE1 protein network | https://string-db.org/network/866895.HBHAL_3775 | Spermidine synthase; Catalyzes the irreversible transfer of a propylamine group from the amino donor S-adenosylmethioninamine (decarboxy-AdoMet) to putrescine (1,4-diaminobutane) to yield spermid [...] |
| yshE2 protein network | https://string-db.org/network/866895.HBHAL_3776 | UPF0719 family protein. |
| CCG46122.1 protein network | https://string-db.org/network/866895.HBHAL_3777 | Hypothetical protein. |
| pspA protein network | https://string-db.org/network/866895.HBHAL_3778 | Hypothetical protein. |
| CCG46124.1 protein network | https://string-db.org/network/866895.HBHAL_3779 | Conserved hypothetical protein. |
| CCG46125.1 protein network | https://string-db.org/network/866895.HBHAL_3780 | Bile acid/sodium symporter (BASS) family protein. |
| ald2 protein network | https://string-db.org/network/866895.HBHAL_3781 | Alanine dehydrogenase; Belongs to the AlaDH/PNT family. |
| CCG46127.1 protein network | https://string-db.org/network/866895.HBHAL_3782 | 3-oxoacyl-[acyl-carrier-protein] reductase. |
| CCG46128.1 protein network | https://string-db.org/network/866895.HBHAL_3783 | Nucleobase/cation symporter-1 family protein. |
| CCG46129.1 protein network | https://string-db.org/network/866895.HBHAL_3784 | Hypothetical protein. |
| uspA5 protein network | https://string-db.org/network/866895.HBHAL_3785 | UspA domain protein. |
| moaB protein network | https://string-db.org/network/866895.HBHAL_3786 | Molybdenum cofactor biosynthesis protein MoaB; May be involved in the biosynthesis of molybdopterin. Belongs to the MoaB/Mog family. |
| CCG46132.1 protein network | https://string-db.org/network/866895.HBHAL_3787 | Hypothetical protein. |
| ackA protein network | https://string-db.org/network/866895.HBHAL_3788 | Acetate kinase; Catalyzes the formation of acetyl phosphate from acetate and ATP. Can also catalyze the reverse reaction; Belongs to the acetokinase family. |
| CCG46134.1 protein network | https://string-db.org/network/866895.HBHAL_3789 | Putative DNA-methyltransferase. |
| ppnK2 protein network | https://string-db.org/network/866895.HBHAL_3790 | Inorganic polyphosphate/ATP-NAD kinase; Involved in the regulation of the intracellular balance of NAD and NADP, and is a key enzyme in the biosynthesis of NADP. Catalyzes specifically the phosph [...] |
| CCG46136.1 protein network | https://string-db.org/network/866895.HBHAL_3791 | Amidohydrolase family protein. |
| thiI protein network | https://string-db.org/network/866895.HBHAL_3792 | Thiamine biosynthesis protein ThiI; Catalyzes the ATP-dependent transfer of a sulfur to tRNA to produce 4-thiouridine in position 8 of tRNAs, which functions as a near-UV photosensor. Also cataly [...] |
| CCG46138.1 protein network | https://string-db.org/network/866895.HBHAL_3793 | Aminotransferase. |
| CCG46139.1 protein network | https://string-db.org/network/866895.HBHAL_3794 | Hypothetical protein. |
| ezrA protein network | https://string-db.org/network/866895.HBHAL_3795 | Septation ring formation regulator; Negative regulator of FtsZ ring formation; modulates the frequency and position of FtsZ ring formation. Inhibits FtsZ ring formation at polar sites. Interacts [...] |
| hisJ1 protein network | https://string-db.org/network/866895.HBHAL_3796 | Histidinol-phosphatase; Belongs to the PHP hydrolase family. HisK subfamily. |
| CCG46142.1 protein network | https://string-db.org/network/866895.HBHAL_3797 | TetR family transcription regulator. |
| ytsP protein network | https://string-db.org/network/866895.HBHAL_3798 | GAF domain protein. |
| rpsD protein network | https://string-db.org/network/866895.HBHAL_3801 | Diguanylate cyclase domain protein (nonfunctional); One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the body of the 30S subunit. |
| CCG46146.1 protein network | https://string-db.org/network/866895.HBHAL_3802 | Conserved hypothetical protein. |
| tyrS protein network | https://string-db.org/network/866895.HBHAL_3803 | tyrosyl-tRNA synthetase; Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two- step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of [...] |
| CCG46148.1 protein network | https://string-db.org/network/866895.HBHAL_3804 | Penicillin binding protein. |
| acuA protein network | https://string-db.org/network/866895.HBHAL_3805 | Acetoin utilization protein. |
| acuB protein network | https://string-db.org/network/866895.HBHAL_3806 | Acetoin utilization protein AcuB. |
| acuC protein network | https://string-db.org/network/866895.HBHAL_3807 | Acetoin utilization protein AcuC. |
| motS protein network | https://string-db.org/network/866895.HBHAL_3808 | Flagellar motor protein MotS. |
| motP protein network | https://string-db.org/network/866895.HBHAL_3809 | Flagellar motor protein MotP. |
| ccpA protein network | https://string-db.org/network/866895.HBHAL_3810 | Catabolite control protein A. |
| aroG protein network | https://string-db.org/network/866895.HBHAL_3811 | Bifunctional 3-deoxy-7-phosphoheptulonate synthase / chorismate mutase. |
| ytxJ1 protein network | https://string-db.org/network/866895.HBHAL_3812 | Conserved hypothetical protein. |
| CCG46157.1 protein network | https://string-db.org/network/866895.HBHAL_3813 | Conserved hypothetical protein. |
| ytxG1 protein network | https://string-db.org/network/866895.HBHAL_3814 | UPF0478 family protein. |
| murC protein network | https://string-db.org/network/866895.HBHAL_3815 | UDP-N-acetylmuramate--L-alanine ligase; Cell wall formation; Belongs to the MurCDEF family. |
| pncB protein network | https://string-db.org/network/866895.HBHAL_3816 | Nicotinate phosphoribosyltransferase; Belongs to the NAPRTase family. |
| sftA protein network | https://string-db.org/network/866895.HBHAL_3817 | DNA translocase SftA; Belongs to the FtsK/SpoIIIE/SftA family. |
| ytpR protein network | https://string-db.org/network/866895.HBHAL_3818 | Conserved hypothetical protein; Belongs to the phenylalanyl-tRNA synthetase beta subunit family. Type 1 subfamily. |
| ytpQ protein network | https://string-db.org/network/866895.HBHAL_3819 | Hypothetical protein; Belongs to the UPF0354 family. |
| trxA3 protein network | https://string-db.org/network/866895.HBHAL_3820 | Thioredoxin. |
| CCG46165.1 protein network | https://string-db.org/network/866895.HBHAL_3821 | Conserved hypothetical protein. |
| CCG46166.1 protein network | https://string-db.org/network/866895.HBHAL_3822 | Hypothetical protein. |
| ytoQ protein network | https://string-db.org/network/866895.HBHAL_3823 | Hypothetical protein. |
| yjjX protein network | https://string-db.org/network/866895.HBHAL_3824 | NTPase; Phosphatase that hydrolyzes non-canonical purine nucleotides such as XTP and ITP to their respective diphosphate derivatives. Probably excludes non-canonical purines from DNA/RNA precurso [...] |
| ytoP protein network | https://string-db.org/network/866895.HBHAL_3825 | Deblocking aminopeptidase, M42 family. |
| ytzB protein network | https://string-db.org/network/866895.HBHAL_3826 | Hypothetical protein. |
| CCG46171.1 protein network | https://string-db.org/network/866895.HBHAL_3827 | Metal-dependent hydrolase. |
| trmB protein network | https://string-db.org/network/866895.HBHAL_3828 | tRNA (guanine-N(7)-)-methyltransferase; Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. |
| CCG46173.1 protein network | https://string-db.org/network/866895.HBHAL_3829 | Hypothetical protein. |
| ytmP protein network | https://string-db.org/network/866895.HBHAL_3830 | Aminoglycoside phosphotransferase family protein. |
| CCG46175.1 protein network | https://string-db.org/network/866895.HBHAL_3831 | Probable lipid kinase (homolog to diacylglycerol kinase). |
| CCG46176.1 protein network | https://string-db.org/network/866895.HBHAL_3832 | Diguanylate phosphodiesterase domain protein. |
| ytlQ protein network | https://string-db.org/network/866895.HBHAL_3833 | Hypothetical protein. |
| ytlP protein network | https://string-db.org/network/866895.HBHAL_3834 | 2'-5' RNA ligase family protein, putative; Hydrolyzes RNA 2',3'-cyclic phosphodiester to an RNA 2'- phosphomonoester; Belongs to the 2H phosphoesterase superfamily. ThpR family. |
| CCG46179.1 protein network | https://string-db.org/network/866895.HBHAL_3835 | MFS-type transporter (probable substrate maltose). |
| ytjP protein network | https://string-db.org/network/866895.HBHAL_3836 | Xaa-His dipeptidase. |
| CCG46181.1 protein network | https://string-db.org/network/866895.HBHAL_3837 | Potassium channel protein. |
| CCG46182.1 protein network | https://string-db.org/network/866895.HBHAL_3838 | Pseudouridine synthase; Belongs to the pseudouridine synthase RsuA family. |
| CCG46183.1 protein network | https://string-db.org/network/866895.HBHAL_3839 | Spore cortex protein. |
| ytfP protein network | https://string-db.org/network/866895.HBHAL_3840 | Conserved hypothetical protein. |
| CCG46186.1 protein network | https://string-db.org/network/866895.HBHAL_3842 | Hypothetical protein. |
| CCG46187.1 protein network | https://string-db.org/network/866895.HBHAL_3844 | Hypothetical protein. |
| CCG46188.1 protein network | https://string-db.org/network/866895.HBHAL_3845 | Rhodanese domain protein. |
| leuS protein network | https://string-db.org/network/866895.HBHAL_3846 | leucyl-tRNA synthetase; Belongs to the class-I aminoacyl-tRNA synthetase family. |
| CCG46190.1 protein network | https://string-db.org/network/866895.HBHAL_3847 | Hypothetical protein. |
| CCG46191.1 protein network | https://string-db.org/network/866895.HBHAL_3848 | Hypothetical protein. |
| ytqB protein network | https://string-db.org/network/866895.HBHAL_3849 | Probable rRNA methylase YtqB. |
| ytpB protein network | https://string-db.org/network/866895.HBHAL_3850 | Hypothetical protein. |
| ytpA protein network | https://string-db.org/network/866895.HBHAL_3851 | Alpha/beta fold hydrolase. |
| ytoA protein network | https://string-db.org/network/866895.HBHAL_3852 | Bacterial transferase family protein. |
| metK protein network | https://string-db.org/network/866895.HBHAL_3853 | S-adenosylmethionine synthetase; Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet forma [...] |
| CCG46197.1 protein network | https://string-db.org/network/866895.HBHAL_3854 | Hypothetical protein. |
| pckA protein network | https://string-db.org/network/866895.HBHAL_3855 | Phosphoenolpyruvate carboxykinase; Involved in the gluconeogenesis. Catalyzes the conversion of oxaloacetate (OAA) to phosphoenolpyruvate (PEP) through direct phosphoryl transfer between the nucl [...] |
| ytkD protein network | https://string-db.org/network/866895.HBHAL_3856 | 8-oxo-dGTP diphosphatase YtkD; Belongs to the Nudix hydrolase family. |
| CCG46200.1 protein network | https://string-db.org/network/866895.HBHAL_3857 | Hypothetical protein. |
| CCG46201.1 protein network | https://string-db.org/network/866895.HBHAL_3858 | Hypothetical protein. |
| menC protein network | https://string-db.org/network/866895.HBHAL_3859 | O-succinylbenzoate-CoA synthase; Converts 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylate (SHCHC) to 2-succinylbenzoate (OSB). |
| menE protein network | https://string-db.org/network/866895.HBHAL_3860 | O-succinylbenzoic acid--CoA ligase; Converts 2-succinylbenzoate (OSB) to 2-succinylbenzoyl-CoA (OSB-CoA); Belongs to the ATP-dependent AMP-binding enzyme family. MenE subfamily. |
| menB protein network | https://string-db.org/network/866895.HBHAL_3861 | Naphthoate synthase; Converts o-succinylbenzoyl-CoA (OSB-CoA) to 1,4-dihydroxy-2- naphthoyl-CoA (DHNA-CoA). |
| menH protein network | https://string-db.org/network/866895.HBHAL_3862 | 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase; Catalyzes a proton abstraction reaction that results in 2,5- elimination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cy [...] |
| menD protein network | https://string-db.org/network/866895.HBHAL_3863 | 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase; Catalyzes the thiamine diphosphate-dependent decarboxylation of 2-oxoglutarate and the subsequent [...] |
| menF protein network | https://string-db.org/network/866895.HBHAL_3864 | Menaquinone-specific isochorismate synthase; Catalyzes the conversion of chorismate to isochorismate. |
| CCG46208.1 protein network | https://string-db.org/network/866895.HBHAL_3865 | Hypothetical protein. |
| menA protein network | https://string-db.org/network/866895.HBHAL_3866 | 1,4-dihydroxy-2-naphthoateoctaprenyltransferase; Conversion of 1,4-dihydroxy-2-naphthoate (DHNA) to demethylmenaquinone (DMK); Belongs to the MenA family. Type 1 subfamily. |
| yuxO protein network | https://string-db.org/network/866895.HBHAL_3867 | Thioesterase family protein. |
| CCG46211.1 protein network | https://string-db.org/network/866895.HBHAL_3868 | Conserved hypothetical protein. |
| ypaA protein network | https://string-db.org/network/866895.HBHAL_3869 | Hypothetical protein; Mediates riboflavin uptake, may also transport FMN and roseoflavin. Probably a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporte [...] |
| CCG46213.1 protein network | https://string-db.org/network/866895.HBHAL_3870 | Hypothetical protein. |
| CCG46214.1 protein network | https://string-db.org/network/866895.HBHAL_3872 | Conserved hypothetical protein. |
| amiC protein network | https://string-db.org/network/866895.HBHAL_3874 | N-acetylmuramoyl-L-alanine amidase. |
| CCG46217.1 protein network | https://string-db.org/network/866895.HBHAL_3875 | Conserved hypothetical protein. |
| CCG46218.1 protein network | https://string-db.org/network/866895.HBHAL_3876 | Conserved hypothetical protein. |
| CCG46219.1 protein network | https://string-db.org/network/866895.HBHAL_3877 | Acetyltransferase, GNAT family. |
| CCG46220.1 protein network | https://string-db.org/network/866895.HBHAL_3878 | Hypothetical protein. |
| CCG46221.1 protein network | https://string-db.org/network/866895.HBHAL_3879 | Endoglucanase. |
| CCG46222.1 protein network | https://string-db.org/network/866895.HBHAL_3880 | Hypothetical protein. |
| CCG46223.1 protein network | https://string-db.org/network/866895.HBHAL_3881 | Potassium channel protein. |
| yugN protein network | https://string-db.org/network/866895.HBHAL_3882 | Hypothetical protein. |
| pgi protein network | https://string-db.org/network/866895.HBHAL_3883 | Glucose-6-phosphate isomerase; Belongs to the GPI family. |
| CCG46227.1 protein network | https://string-db.org/network/866895.HBHAL_3885 | Alcohol dehydrogenase. |
| yuzA protein network | https://string-db.org/network/866895.HBHAL_3886 | Conserved hypothetical protein. |
| yugI protein network | https://string-db.org/network/866895.HBHAL_3887 | General stress protein YugI. |
| CCG46230.1 protein network | https://string-db.org/network/866895.HBHAL_3888 | SinR/xre family transcription regulator. |
| patB protein network | https://string-db.org/network/866895.HBHAL_3889 | Cystathionine beta-lyase PatB. |
| sodC3 protein network | https://string-db.org/network/866895.HBHAL_3890 | Superoxide dismutase (Cu/Zn); Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Belongs to the Cu-Zn superoxide dismutase family. |
| CCG46233.1 protein network | https://string-db.org/network/866895.HBHAL_3891 | Hypothetical protein. |
| kapB protein network | https://string-db.org/network/866895.HBHAL_3892 | Kinase-associated protein KapB. |
| CCG46235.1 protein network | https://string-db.org/network/866895.HBHAL_3893 | Na+/H+ antiporter family protein. |
| yhaT protein network | https://string-db.org/network/866895.HBHAL_3894 | TrkA-C domain protein. |
| deoD protein network | https://string-db.org/network/866895.HBHAL_3895 | Purine nucleoside phosphorylase. |
| CCG46238.1 protein network | https://string-db.org/network/866895.HBHAL_3896 | Hypothetical protein. |
| yuiD1 protein network | https://string-db.org/network/866895.HBHAL_3897 | Conserved hypothetical protein. |
| yuiC protein network | https://string-db.org/network/866895.HBHAL_3898 | Conserved hypothetical protein. |
| yuiB protein network | https://string-db.org/network/866895.HBHAL_3899 | Conserved hypothetical protein. |
| CCG46243.1 protein network | https://string-db.org/network/866895.HBHAL_3901 | NADH dehydrogenase. |
| CCG46244.1 protein network | https://string-db.org/network/866895.HBHAL_3902 | ferredoxin--NADP reductase. |
| CCG46245.1 protein network | https://string-db.org/network/866895.HBHAL_3903 | Hypothetical protein. |
| yutM protein network | https://string-db.org/network/866895.HBHAL_3904 | Hypothetical protein; Belongs to the HesB/IscA family. |
| CCG46247.1 protein network | https://string-db.org/network/866895.HBHAL_3905 | Hypothetical protein. |
| CCG46248.1 protein network | https://string-db.org/network/866895.HBHAL_3906 | UPF0349 family protein. |
| CCG46249.1 protein network | https://string-db.org/network/866895.HBHAL_3907 | Conserved hypothetical protein. |
| CCG46250.1 protein network | https://string-db.org/network/866895.HBHAL_3908 | Hypothetical protein. |
| yutI protein network | https://string-db.org/network/866895.HBHAL_3909 | Conserved hypothetical protein. |
| CCG46252.1 protein network | https://string-db.org/network/866895.HBHAL_3910 | Probable 2-hydroxyacid dehydrogenase (NAD); Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. |
| yutG protein network | https://string-db.org/network/866895.HBHAL_3911 | Low temperature requirement C protein. |
| CCG46254.1 protein network | https://string-db.org/network/866895.HBHAL_3912 | Hypothetical protein. |
| CCG46255.1 protein network | https://string-db.org/network/866895.HBHAL_3913 | HAD superfamily hydrolase; Catalyzes the dephosphorylation of 2-6 carbon acid sugars in vitro; Belongs to the HAD-like hydrolase superfamily. NagD family. |
| yutE protein network | https://string-db.org/network/866895.HBHAL_3914 | Hypothetical protein. |
| fbp2 protein network | https://string-db.org/network/866895.HBHAL_3915 | Fructose 1,6-bisphosphatase, class II. |
| CCG46258.1 protein network | https://string-db.org/network/866895.HBHAL_3916 | Hypothetical protein. |
| CCG46259.1 protein network | https://string-db.org/network/866895.HBHAL_3917 | Hypothetical protein. |
| yutD protein network | https://string-db.org/network/866895.HBHAL_3918 | Hypothetical protein. |
| CCG46261.1 protein network | https://string-db.org/network/866895.HBHAL_3919 | Conserved hypothetical protein. |
| yunA protein network | https://string-db.org/network/866895.HBHAL_3920 | Hypothetical protein. |
| CCG46264.1 protein network | https://string-db.org/network/866895.HBHAL_3922 | Sodium-dependent transporter family protein. |
| CCG46265.1 protein network | https://string-db.org/network/866895.HBHAL_3923 | Conserved hypothetical protein. |
| CCG46266.1 protein network | https://string-db.org/network/866895.HBHAL_3924 | Conserved hypothetical protein. |
| yunD protein network | https://string-db.org/network/866895.HBHAL_3925 | Probable metallophosphoesterase; Belongs to the 5'-nucleotidase family. |
| CCG46268.1 protein network | https://string-db.org/network/866895.HBHAL_3926 | UPF0721 family protein. |
| sufB protein network | https://string-db.org/network/866895.HBHAL_3927 | Fe-S cluster assembly protein SufB. |
| nifU protein network | https://string-db.org/network/866895.HBHAL_3928 | NifU family iron-sulfur cluster assembly protein. |
| CCG46271.1 protein network | https://string-db.org/network/866895.HBHAL_3929 | Cysteine desulfurase; Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. |
| sufD protein network | https://string-db.org/network/866895.HBHAL_3930 | FeS cluster assembly protein SufD. |
| CCG46273.1 protein network | https://string-db.org/network/866895.HBHAL_3931 | ABC-type transport system ATP-binding protein. |
| CCG46274.1 protein network | https://string-db.org/network/866895.HBHAL_3932 | Hypothetical protein. |
| CCG46275.1 protein network | https://string-db.org/network/866895.HBHAL_3933 | Putative carboxymuconolactone decarboxylase. |
| metQ1 protein network | https://string-db.org/network/866895.HBHAL_3934 | ABC-type transport system extracellular binding protein (probable substrate methionine); Belongs to the nlpA lipoprotein family. |
| metP1 protein network | https://string-db.org/network/866895.HBHAL_3935 | ABC-type transport system permease protein (probable substrate methionine). |
| metN1 protein network | https://string-db.org/network/866895.HBHAL_3936 | ABC-type transport system ATP-binding protein (probable substrate methionine); Part of the ABC transporter complex MetNIQ involved in methionine import. Responsible for energy coupling to the tra [...] |
| CCG46279.1 protein network | https://string-db.org/network/866895.HBHAL_3937 | Thioredoxin. |
| yusE protein network | https://string-db.org/network/866895.HBHAL_3938 | Thioredoxin. |
| CCG46281.1 protein network | https://string-db.org/network/866895.HBHAL_3939 | Conserved hypothetical protein. |
| gcvH protein network | https://string-db.org/network/866895.HBHAL_3941 | Glycine cleavage system protein H; Is also involved in protein lipoylation via its role as an octanoyl/lipoyl carrier protein intermediate; Belongs to the GcvH family. |
| CCG46284.1 protein network | https://string-db.org/network/866895.HBHAL_3942 | MgsR/Spx family transcription regulator; Belongs to the ArsC family. |
| CCG46285.1 protein network | https://string-db.org/network/866895.HBHAL_3943 | acyl-CoA dehydrogenase. |
| CCG46286.1 protein network | https://string-db.org/network/866895.HBHAL_3944 | acetyl-CoA acetyltransferase; Belongs to the thiolase-like superfamily. Thiolase family. |
| CCG46287.1 protein network | https://string-db.org/network/866895.HBHAL_3945 | 3-hydroxyacyl-CoA dehydrogenase. |
| prodh1 protein network | https://string-db.org/network/866895.HBHAL_3946 | Proline dehydrogenase. |
| CCG46289.1 protein network | https://string-db.org/network/866895.HBHAL_3947 | Conserved hypothetical protein. |
| yusN protein network | https://string-db.org/network/866895.HBHAL_3948 | Hypothetical protein. |
| copZ1 protein network | https://string-db.org/network/866895.HBHAL_3949 | Copper chaperone CopZ. |
| CCG46293.1 protein network | https://string-db.org/network/866895.HBHAL_3951 | Hypothetical protein. |
| CCG46294.1 protein network | https://string-db.org/network/866895.HBHAL_3952 | Cobalamin-binding domain protein. |
| CCG46295.1 protein network | https://string-db.org/network/866895.HBHAL_3953 | Hypothetical protein. |
| CCG46296.1 protein network | https://string-db.org/network/866895.HBHAL_3954 | Hypothetical protein. |
| yocB protein network | https://string-db.org/network/866895.HBHAL_3955 | Conserved hypothetical protein. |
| CCG46298.1 protein network | https://string-db.org/network/866895.HBHAL_3956 | Hypothetical protein. |
| CCG46299.1 protein network | https://string-db.org/network/866895.HBHAL_3957 | Hypothetical protein. |
| moxR protein network | https://string-db.org/network/866895.HBHAL_3958 | MoxR family AAA-type ATPase. |
| CCG46301.1 protein network | https://string-db.org/network/866895.HBHAL_3959 | ABC-type transport system extracellular binding protein (probable substrate glycine betaine/proline). |
| CCG46302.1 protein network | https://string-db.org/network/866895.HBHAL_3960 | Hypothetical protein. |
| CCG46303.1 protein network | https://string-db.org/network/866895.HBHAL_3961 | MFS-type transporter (probable function chloramphenicol resistance). |
| CCG46304.1 protein network | https://string-db.org/network/866895.HBHAL_3962 | TrmB family transcription regulator. |
| CCG46306.1 protein network | https://string-db.org/network/866895.HBHAL_3964 | Hypothetical protein. |
| CCG46307.1 protein network | https://string-db.org/network/866895.HBHAL_3965 | Putative beta-ketoadipate enol-lactone hydrolase. |
| yrzF protein network | https://string-db.org/network/866895.HBHAL_3966 | Hypothetical protein. |
| CCG46309.1 protein network | https://string-db.org/network/866895.HBHAL_3967 | Small acid-soluble spore protein. |
| CCG46310.1 protein network | https://string-db.org/network/866895.HBHAL_3968 | Hypothetical protein. |
| CCG46311.1 protein network | https://string-db.org/network/866895.HBHAL_3969 | Hypothetical protein. |
| yoaI protein network | https://string-db.org/network/866895.HBHAL_3970 | 4-hydroxyphenylacetate-3-hydroxylase. |
| CCG46313.1 protein network | https://string-db.org/network/866895.HBHAL_3971 | Isocitrate lyase. |
| CCG46314.1 protein network | https://string-db.org/network/866895.HBHAL_3972 | Malate synthase; Belongs to the malate synthase family. |
| CCG46315.1 protein network | https://string-db.org/network/866895.HBHAL_3973 | Aldo/keto reductase family protein. |
| CCG46316.1 protein network | https://string-db.org/network/866895.HBHAL_3974 | Hypothetical protein. |
| CCG46317.1 protein network | https://string-db.org/network/866895.HBHAL_3975 | Phosphoglycerate mutase family protein. |
| ilvD protein network | https://string-db.org/network/866895.HBHAL_3976 | Dihydroxy-acid dehydratase; Belongs to the IlvD/Edd family. |
| murB protein network | https://string-db.org/network/866895.HBHAL_3977 | UDP-N-acetylenolpyruvoylglucosamine reductase; Cell wall formation. |
| CCG46320.1 protein network | https://string-db.org/network/866895.HBHAL_3978 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| ypjP protein network | https://string-db.org/network/866895.HBHAL_3979 | Hypothetical protein. |
| yhcQ protein network | https://string-db.org/network/866895.HBHAL_3980 | Hypothetical protein. |
| yqcI protein network | https://string-db.org/network/866895.HBHAL_3981 | Conserved hypothetical protein. |
| ykgA protein network | https://string-db.org/network/866895.HBHAL_3982 | Hypothetical protein. |
| dhaM protein network | https://string-db.org/network/866895.HBHAL_3983 | Dihydroxyacetone kinase phosphotransfer subunit. |
| dhaL protein network | https://string-db.org/network/866895.HBHAL_3984 | Dihydroxyacetone kinase subunit DhaL. |
| dhaK protein network | https://string-db.org/network/866895.HBHAL_3985 | Dihydroxyacetone kinase subunit DhaK. |
| glpK-2 protein network | https://string-db.org/network/866895.HBHAL_3986 | Glycerol kinase; Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn- glycerol 3-phosphate; Belongs to the FGGY kinase family. |
| CCG46329.1 protein network | https://string-db.org/network/866895.HBHAL_3987 | MIP family channel protein (probable substrate glycerol); Belongs to the MIP/aquaporin (TC 1.A.8) family. |
| smpB protein network | https://string-db.org/network/866895.HBHAL_3988 | SsrA-binding protein; Required for rescue of stalled ribosomes mediated by trans- translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tm [...] |
| CCG46331.1 protein network | https://string-db.org/network/866895.HBHAL_3989 | Hypothetical protein. |
| rnr protein network | https://string-db.org/network/866895.HBHAL_3990 | Ribonuclease R; 3'-5' exoribonuclease that releases 5'-nucleoside monophosphates and is involved in maturation of structured RNAs. |
| est protein network | https://string-db.org/network/866895.HBHAL_3991 | Carboxylesterase. |
| secG protein network | https://string-db.org/network/866895.HBHAL_3992 | Preprotein translocase subunit SecG; Involved in protein export. Participates in an early event of protein translocation; Belongs to the SecG family. |
| CCG46335.1 protein network | https://string-db.org/network/866895.HBHAL_3993 | DeoR family transcription regulator. |
| CCG46336.1 protein network | https://string-db.org/network/866895.HBHAL_3994 | 1-phosphofructokinase; Belongs to the carbohydrate kinase PfkB family. LacC subfamily. |
| CCG46337.1 protein network | https://string-db.org/network/866895.HBHAL_3995 | PTS system subunit IIBC, fructose-specific. |
| CCG46338.1 protein network | https://string-db.org/network/866895.HBHAL_3996 | Phosphocarrier protein HPr. |
| CCG46339.1 protein network | https://string-db.org/network/866895.HBHAL_3997 | PTS system subunit I; General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system cata [...] |
| CCG46340.1 protein network | https://string-db.org/network/866895.HBHAL_3998 | Hypothetical protein. |
| CCG46341.1 protein network | https://string-db.org/network/866895.HBHAL_3999 | Putative nitroreductase family protein. |
| CCG46342.1 protein network | https://string-db.org/network/866895.HBHAL_4000 | Hypothetical protein. |
| eno protein network | https://string-db.org/network/866895.HBHAL_4001 | Phosphopyruvate hydratase (enolase); Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. It is essential for the degradation of carbohydrates via glycolysis; Belon [...] |
| gpmI protein network | https://string-db.org/network/866895.HBHAL_4002 | Phosphoglycerate mutase,2,3-bisphosphoglycerate-independent; Catalyzes the interconversion of 2-phosphoglycerate and 3- phosphoglycerate; Belongs to the BPG-independent phosphoglycerate mutase fa [...] |
| tpiA protein network | https://string-db.org/network/866895.HBHAL_4003 | Triosephosphate isomerase; Involved in the gluconeogenesis. Catalyzes stereospecifically the conversion of dihydroxyacetone phosphate (DHAP) to D- glyceraldehyde-3-phosphate (G3P); Belongs to the [...] |
| pgk protein network | https://string-db.org/network/866895.HBHAL_4004 | Phosphoglycerate kinase; Belongs to the phosphoglycerate kinase family. |
| gapA protein network | https://string-db.org/network/866895.HBHAL_4005 | Glyceraldehyde-3-phosphate dehydrogenase; Belongs to the glyceraldehyde-3-phosphate dehydrogenase family. |
| cggR protein network | https://string-db.org/network/866895.HBHAL_4006 | Transcription regulator CggR. |
| CCG46349.1 protein network | https://string-db.org/network/866895.HBHAL_4007 | Glutaredoxin. |
| CCG46350.1 protein network | https://string-db.org/network/866895.HBHAL_4008 | Hypothetical protein. |
| CCG46351.1 protein network | https://string-db.org/network/866895.HBHAL_4009 | IS1341-type transposase. |
| clpP protein network | https://string-db.org/network/866895.HBHAL_4011 | ATP-dependent Clp protease proteolytic subunit; Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degrada [...] |
| CCG46353.1 protein network | https://string-db.org/network/866895.HBHAL_4012 | PTS system phosphocarrier protein HPr. |
| whiA protein network | https://string-db.org/network/866895.HBHAL_4013 | Conserved hypothetical protein; Involved in cell division and chromosome segregation. |
| CCG46355.1 protein network | https://string-db.org/network/866895.HBHAL_4014 | UPF0052 family protein; Required for morphogenesis under gluconeogenic growth conditions; Belongs to the gluconeogenesis factor family. |
| CCG46356.1 protein network | https://string-db.org/network/866895.HBHAL_4015 | UPF0042 family nucleotide-binding protein; Displays ATPase and GTPase activities. |
| CCG46357.1 protein network | https://string-db.org/network/866895.HBHAL_4016 | MutT/NUDIX family protein. |
| CCG46358.1 protein network | https://string-db.org/network/866895.HBHAL_4017 | Thioredoxin-disulfide reductase. |
| yvcD protein network | https://string-db.org/network/866895.HBHAL_4018 | Hypothetical protein. |
| hisI protein network | https://string-db.org/network/866895.HBHAL_4019 | Bifunctional phosphoribosyl-ATP diphosphatase / phosphoribosyl-AMP cyclohydrolase; In the N-terminal section; belongs to the PRA-CH family. |
| hisF protein network | https://string-db.org/network/866895.HBHAL_4020 | Imidazoleglycerol-phosphate synthase subunit HisF; IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisF subunit catalyzes the cyclization activity that produ [...] |
| hisA protein network | https://string-db.org/network/866895.HBHAL_4021 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase. |
| hisH protein network | https://string-db.org/network/866895.HBHAL_4022 | Imidazoleglycerol-phosphate synthase subunit HisH; IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glut [...] |
| hisB protein network | https://string-db.org/network/866895.HBHAL_4023 | Imidazoleglycerol-phosphate dehydratase. |
| hisD protein network | https://string-db.org/network/866895.HBHAL_4024 | Histidinol dehydrogenase; Catalyzes the sequential NAD-dependent oxidations of L- histidinol to L-histidinaldehyde and then to L-histidine. |
| hisG protein network | https://string-db.org/network/866895.HBHAL_4025 | ATP phosphoribosyltransferase; Catalyzes the condensation of ATP and 5-phosphoribose 1- diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP). Has a crucial role in the pathway because the rate [...] |
| hisZ protein network | https://string-db.org/network/866895.HBHAL_4026 | ATP phosphoribosyltransferase regulatory subunit; Required for the first step of histidine biosynthesis. May allow the feedback regulation of ATP phosphoribosyltransferase activity by histidine. |
| CCG46368.1 protein network | https://string-db.org/network/866895.HBHAL_4027 | Putative acyl-CoA dehydrogenase. |
| CCG46369.1 protein network | https://string-db.org/network/866895.HBHAL_4028 | AMP-dependent synthetase and ligase. |
| CCG46370.1 protein network | https://string-db.org/network/866895.HBHAL_4029 | GlnR/MerR family transcription regulator. |
| CCG46371.1 protein network | https://string-db.org/network/866895.HBHAL_4030 | Hypothetical protein. |
| CCG46372.1 protein network | https://string-db.org/network/866895.HBHAL_4031 | Glycerol-3-phosphate dehydrogenase; Belongs to the FAD-dependent glycerol-3-phosphate dehydrogenase family. |
| glpK protein network | https://string-db.org/network/866895.HBHAL_4032 | Glycerol kinase; Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn- glycerol 3-phosphate; Belongs to the FGGY kinase family. |
| CCG46374.1 protein network | https://string-db.org/network/866895.HBHAL_4033 | Glycerol uptake facilitator; Belongs to the MIP/aquaporin (TC 1.A.8) family. |
| CCG46375.1 protein network | https://string-db.org/network/866895.HBHAL_4034 | Glycerol uptake operon antiterminator regulatory protein; Regulates expression of the glpD operon. In the presence of glycerol 3-phosphate (G3P) causes antitermination of transcription of glpD at [...] |
| yvoF protein network | https://string-db.org/network/866895.HBHAL_4035 | Probable acetyltransferase. |
| ppaX protein network | https://string-db.org/network/866895.HBHAL_4036 | Pyrophosphatase PpaX. |
| yvoD protein network | https://string-db.org/network/866895.HBHAL_4037 | Hypothetical protein. |
| lgt protein network | https://string-db.org/network/866895.HBHAL_4038 | Prolipoprotein diacylglyceryl transferase; Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the [...] |
| hprK protein network | https://string-db.org/network/866895.HBHAL_4039 | HPr kinase/phosphorylase; Catalyzes the ATP- as well as the pyrophosphate-dependent phosphorylation of a specific serine residue in HPr, a phosphocarrier protein of the phosphoenolpyruvate-depend [...] |
| CCG46381.1 protein network | https://string-db.org/network/866895.HBHAL_4040 | Hypothetical protein. |
| yvlD protein network | https://string-db.org/network/866895.HBHAL_4041 | Conserved hypothetical protein. |
| yvlB protein network | https://string-db.org/network/866895.HBHAL_4042 | Hypothetical protein. |
| CCG46384.1 protein network | https://string-db.org/network/866895.HBHAL_4043 | Hypothetical protein. |
| CCG46385.1 protein network | https://string-db.org/network/866895.HBHAL_4044 | Hypothetical protein. |
| uvrA protein network | https://string-db.org/network/866895.HBHAL_4045 | Excinuclease ABC subunit A; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrA is an ATPase and a DNA-binding protein. A damage recognition complex composed of [...] |
| uvrB protein network | https://string-db.org/network/866895.HBHAL_4046 | Excinuclease ABC subunit B; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abn [...] |
| CCG46388.1 protein network | https://string-db.org/network/866895.HBHAL_4047 | Two-component sensor histidine kinase / two-component response regulator. |
| CCG46389.1 protein network | https://string-db.org/network/866895.HBHAL_4048 | Two-component response regulator. |
| CCG46390.1 protein network | https://string-db.org/network/866895.HBHAL_4049 | Diguanylate cyclase domain protein / two-component response regulator. |
| prfC protein network | https://string-db.org/network/866895.HBHAL_4050 | Peptide chain release factor RF3; Increases the formation of ribosomal termination complexes and stimulates activities of RF-1 and RF-2. It binds guanine nucleotides and has strong preference for [...] |
| CCG46392.1 protein network | https://string-db.org/network/866895.HBHAL_4051 | Non-specific serine/threonine protein kinase. |
| CCG46393.1 protein network | https://string-db.org/network/866895.HBHAL_4052 | Conserved hypothetical protein. |
| ctaA protein network | https://string-db.org/network/866895.HBHAL_4053 | Heme A synthase. |
| CCG46395.1 protein network | https://string-db.org/network/866895.HBHAL_4054 | Hypothetical protein. |
| capD2 protein network | https://string-db.org/network/866895.HBHAL_4055 | Capsule depolymerase CapD. |
| capA2 protein network | https://string-db.org/network/866895.HBHAL_4056 | PGA biosynthesis protein CapA. |
| capC2 protein network | https://string-db.org/network/866895.HBHAL_4057 | PGA biosynthesis protein CapC. |
| capB2 protein network | https://string-db.org/network/866895.HBHAL_4058 | PGA synthase CapB. |
| CCG46400.1 protein network | https://string-db.org/network/866895.HBHAL_4059 | Hypothetical protein. |
| CCG46401.1 protein network | https://string-db.org/network/866895.HBHAL_4060 | Hypothetical protein. |
| CCG46402.1 protein network | https://string-db.org/network/866895.HBHAL_4061 | ABC-type transport system ATP-binding protein (probable substrate iron-III-dicitrate). |
| swrB protein network | https://string-db.org/network/866895.HBHAL_4062 | Hypothetical protein. |
| yvjB protein network | https://string-db.org/network/866895.HBHAL_4063 | Carboxyl-terminal protease; Belongs to the peptidase S41A family. |
| phnX protein network | https://string-db.org/network/866895.HBHAL_4064 | Phosphonoacetaldehyde phosphonohydrolase; Involved in phosphonate degradation; Belongs to the HAD-like hydrolase superfamily. PhnX family. |
| phnW protein network | https://string-db.org/network/866895.HBHAL_4065 | 2-aminoethylphosphonate:pyruvate aminotransferase; Involved in phosphonate degradation; Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. PhnW subfamily. |
| ftsE protein network | https://string-db.org/network/866895.HBHAL_4066 | ABC-type transport system ATP-binding protein; Part of the ABC transporter FtsEX involved in cellular division. |
| cccB protein network | https://string-db.org/network/866895.HBHAL_4067 | Cytochrome c-551. |
| yvjA protein network | https://string-db.org/network/866895.HBHAL_4068 | Conserved hypothetical protein. |
| gtaB1 protein network | https://string-db.org/network/866895.HBHAL_4069 | UTP-glucose-1-phosphate uridylyltransferase. |
| CCG46411.1 protein network | https://string-db.org/network/866895.HBHAL_4070 | Hypothetical protein. |
| prfB protein network | https://string-db.org/network/866895.HBHAL_4071 | Peptide chain release factor RF2; Peptide chain release factor 2 directs the termination of translation in response to the peptide chain termination codons UGA and UAA. |
| secA1 protein network | https://string-db.org/network/866895.HBHAL_4072 | Preprotein translocase subunit SecA; Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to [...] |
| CCG46414.1 protein network | https://string-db.org/network/866895.HBHAL_4073 | Hypothetical protein. |
| yvyD protein network | https://string-db.org/network/866895.HBHAL_4074 | Putative ribosomal subunit interface protein; Required for dimerization of active 70S ribosomes into 100S ribosomes in stationary phase; 100S ribosomes are translationally inactive and sometimes [...] |
| CCG46416.1 protein network | https://string-db.org/network/866895.HBHAL_4075 | Hypothetical protein. |
| fliT protein network | https://string-db.org/network/866895.HBHAL_4076 | Flagellar protein. |
| fliS protein network | https://string-db.org/network/866895.HBHAL_4077 | Flagellar protein. |
| fliD protein network | https://string-db.org/network/866895.HBHAL_4078 | Flagellar capping protein; Required for morphogenesis and for the elongation of the flagellar filament by facilitating polymerization of the flagellin monomers at the tip of growing filament. For [...] |
| CCG46420.1 protein network | https://string-db.org/network/866895.HBHAL_4079 | Hypothetical protein. |
| csrA protein network | https://string-db.org/network/866895.HBHAL_4080 | Carbon storage regulator homolog; A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'- UTR at or near the Shine-Dalgarno se [...] |
| fliW protein network | https://string-db.org/network/866895.HBHAL_4081 | Flagellar assembly protein; Acts as an anti-CsrA protein, binds CsrA and prevents it from repressing translation of its target genes, one of which is flagellin. Binds to flagellin and participate [...] |
| CCG46423.1 protein network | https://string-db.org/network/866895.HBHAL_4082 | Conserved hypothetical protein. |
| flgL protein network | https://string-db.org/network/866895.HBHAL_4083 | Flagellar hook-associated protein. |
| flgK protein network | https://string-db.org/network/866895.HBHAL_4084 | Flagellar hook-associated protein. |
| CCG46426.1 protein network | https://string-db.org/network/866895.HBHAL_4085 | Conserved hypothetical protein. |
| flgM protein network | https://string-db.org/network/866895.HBHAL_4086 | Anti-sigma factor repressor of sigma-D-dependent transcription. |
| yvyF protein network | https://string-db.org/network/866895.HBHAL_4086_A | Flagellar protein YvyF. |
| comFC protein network | https://string-db.org/network/866895.HBHAL_4087 | Competence protein ComFC. |
| comF protein network | https://string-db.org/network/866895.HBHAL_4088 | ComF operon protein 1. |
| degV3 protein network | https://string-db.org/network/866895.HBHAL_4089 | DegV family protein. |
| CCG46432.1 protein network | https://string-db.org/network/866895.HBHAL_4090 | Two-component response regulator. |
| CCG46433.1 protein network | https://string-db.org/network/866895.HBHAL_4091 | Two-component sensor histidine kinase; Member of the two-component regulatory system DegS/DegU, which plays an important role in the transition growth phase. |
| yvyE protein network | https://string-db.org/network/866895.HBHAL_4092 | Hypothetical protein. |
| CCG46435.1 protein network | https://string-db.org/network/866895.HBHAL_4093 | LytR family transcription regulator. |
| tagO1 protein network | https://string-db.org/network/866895.HBHAL_4094 | Probable undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase. |
| CCG46437.1 protein network | https://string-db.org/network/866895.HBHAL_4095 | Cationic amino acid transporter. |
| CCG46438.1 protein network | https://string-db.org/network/866895.HBHAL_4096 | Conserved hypothetical protein. |
| CCG46439.1 protein network | https://string-db.org/network/866895.HBHAL_4097 | LytR family transcription regulator. |
| CCG46440.1 protein network | https://string-db.org/network/866895.HBHAL_4098 | Hypothetical protein. |
| CCG46441.1 protein network | https://string-db.org/network/866895.HBHAL_4099 | Hypothetical protein. |
| CCG46442.1 protein network | https://string-db.org/network/866895.HBHAL_4100 | Hypothetical protein. |
| amyA protein network | https://string-db.org/network/866895.HBHAL_4101 | Alpha-amylase catalytic region. |
| CCG46444.1 protein network | https://string-db.org/network/866895.HBHAL_4102 | Putative lipoprotein (haemin storage system) (HmsF). |
| galE2 protein network | https://string-db.org/network/866895.HBHAL_4103 | UDP-glucose 4-epimerase; Belongs to the NAD(P)-dependent epimerase/dehydratase family. |
| CCG46446.1 protein network | https://string-db.org/network/866895.HBHAL_4104 | Hypothetical protein. |
| CCG46447.1 protein network | https://string-db.org/network/866895.HBHAL_4105 | Conserved hypothetical protein. |
| CCG46448.1 protein network | https://string-db.org/network/866895.HBHAL_4106 | Conserved hypothetical protein. |
| CCG46449.1 protein network | https://string-db.org/network/866895.HBHAL_4107 | Conserved hypothetical protein. |
| CCG46450.1 protein network | https://string-db.org/network/866895.HBHAL_4108 | Group 1 glycosyltransferase. |
| pelG protein network | https://string-db.org/network/866895.HBHAL_4109 | Hypothetical protein. |
| CCG46452.1 protein network | https://string-db.org/network/866895.HBHAL_4110 | Hypothetical protein. |
| CCG46453.1 protein network | https://string-db.org/network/866895.HBHAL_4111 | Hypothetical protein. |
| CCG46454.1 protein network | https://string-db.org/network/866895.HBHAL_4112 | LacI family transcription regulator. |
| CCG46455.1 protein network | https://string-db.org/network/866895.HBHAL_4113 | ABC-type transport system permease protein (probables substrate maltose/maltodextrin). |
| CCG46456.1 protein network | https://string-db.org/network/866895.HBHAL_4114 | ABC-type transport system permease protein (probable substrate maltose/maltodextrin). |
| CCG46457.1 protein network | https://string-db.org/network/866895.HBHAL_4115 | ABC-type transport system extracellular binding protein (probable substrate maltose/maltodextrin). |
| nplT protein network | https://string-db.org/network/866895.HBHAL_4116 | Alpha-amylase. |
| fdaB protein network | https://string-db.org/network/866895.HBHAL_4117 | Fructose-1,6-bisphosphate aldolase; Belongs to the class I fructose-bisphosphate aldolase family. |
| CCG46460.1 protein network | https://string-db.org/network/866895.HBHAL_4118 | Conserved hypothetical protein. |
| p5cdh2 protein network | https://string-db.org/network/866895.HBHAL_4119 | 1-pyrroline-5-carboxylate dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| prodh2 protein network | https://string-db.org/network/866895.HBHAL_4120 | Proline dehydrogenase. |
| CCG46463.1 protein network | https://string-db.org/network/866895.HBHAL_4121 | Hypothetical protein. |
| CCG46464.1 protein network | https://string-db.org/network/866895.HBHAL_4122 | Anion-transporting ATPase family protein (probable substrate arsenate). |
| CCG46465.1 protein network | https://string-db.org/network/866895.HBHAL_4123 | Conserved hypothetical protein. |
| CCG46466.1 protein network | https://string-db.org/network/866895.HBHAL_4124 | Hypothetical protein. |
| cstA3 protein network | https://string-db.org/network/866895.HBHAL_4125 | Carbon starvation protein CstA. |
| gvpU protein network | https://string-db.org/network/866895.HBHAL_4126 | Gas vesicle protein GvpU. |
| CCG46469.1 protein network | https://string-db.org/network/866895.HBHAL_4127 | Hypothetical protein. |
| gvpJ protein network | https://string-db.org/network/866895.HBHAL_4128 | Gas vesicle protein GvpJ; Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the organism a [...] |
| gvpK protein network | https://string-db.org/network/866895.HBHAL_4129 | Gas vesicle protein GvpK. |
| gvpS protein network | https://string-db.org/network/866895.HBHAL_4130 | Gas vesicle protein GvpS; Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the organism a [...] |
| gvpL protein network | https://string-db.org/network/866895.HBHAL_4131 | Gas vesicle protein GvpL. |
| gvpG protein network | https://string-db.org/network/866895.HBHAL_4132 | Gas vesicle protein GvpG. |
| gvpF protein network | https://string-db.org/network/866895.HBHAL_4133 | Gas vesicle protein GvpF. |
| gvpN protein network | https://string-db.org/network/866895.HBHAL_4134 | Gas vesicle protein GvpN. |
| gvpR protein network | https://string-db.org/network/866895.HBHAL_4135 | Gas vesicle protein GvpR. |
| gvpA protein network | https://string-db.org/network/866895.HBHAL_4136 | Gas vesicle protein GvpA; Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the organism a [...] |
| gvpQ protein network | https://string-db.org/network/866895.HBHAL_4137 | Gas vesicle protein GvpQ. |
| CCG46480.1 protein network | https://string-db.org/network/866895.HBHAL_4138 | Fumarylacetoacetase. |
| yfiQ protein network | https://string-db.org/network/866895.HBHAL_4139 | Intercellular adhesion protein C. |
| CCG46482.1 protein network | https://string-db.org/network/866895.HBHAL_4140 | Hypothetical protein. |
| pcp protein network | https://string-db.org/network/866895.HBHAL_4141 | Pyrrolidone-carboxylate peptidase; Removes 5-oxoproline from various penultimate amino acid residues except L-proline; Belongs to the peptidase C15 family. |
| CCG46484.1 protein network | https://string-db.org/network/866895.HBHAL_4142 | Hypothetical protein. |
| CCG46485.1 protein network | https://string-db.org/network/866895.HBHAL_4143 | Conserved hypothetical protein. |
| CCG46486.1 protein network | https://string-db.org/network/866895.HBHAL_4144 | Conserved hypothetical protein. |
| ybbH protein network | https://string-db.org/network/866895.HBHAL_4145 | RpiR family transcription regulator. |
| CCG46488.1 protein network | https://string-db.org/network/866895.HBHAL_4146 | ABC-type transport system permease protein (probable substrate N-acetylglucosamine). |
| CCG46489.1 protein network | https://string-db.org/network/866895.HBHAL_4147 | ABC-type transport system permease protein (probable substrate N-acetylglucosamine). |
| CCG46490.1 protein network | https://string-db.org/network/866895.HBHAL_4148 | ABC-type transport system extracellular binding protein (probable substrate N-acetylglucosamine). |
| ybbI protein network | https://string-db.org/network/866895.HBHAL_4149 | N-acetylmuramic acid-6-phosphate etherase; Specifically catalyzes the cleavage of the D-lactyl ether substituent of MurNAc 6-phosphate, producing GlcNAc 6-phosphate and D- lactate. |
| CCG46492.1 protein network | https://string-db.org/network/866895.HBHAL_4150 | ATPase, BadF/BadG/BcrA/BcrD type. |
| CCG46493.1 protein network | https://string-db.org/network/866895.HBHAL_4151 | Hypothetical protein; Belongs to the UPF0312 family. |
| CCG46494.1 protein network | https://string-db.org/network/866895.HBHAL_4152 | Hypothetical protein. |
| CCG46495.1 protein network | https://string-db.org/network/866895.HBHAL_4153 | Pyrrolo-quinoline quinone. |
| CCG46496.1 protein network | https://string-db.org/network/866895.HBHAL_4154 | MFS-type transporter (probable function oxalate/formate antiporter). |
| CCG46497.1 protein network | https://string-db.org/network/866895.HBHAL_4155 | Hypothetical protein. |
| CCG46498.1 protein network | https://string-db.org/network/866895.HBHAL_4156 | Hypothetical protein. |
| CCG46499.1 protein network | https://string-db.org/network/866895.HBHAL_4157 | Spore germination protein. |
| CCG46500.1 protein network | https://string-db.org/network/866895.HBHAL_4158 | Hypothetical protein. |
| CCG46501.1 protein network | https://string-db.org/network/866895.HBHAL_4159 | Conserved hypothetical protein. |
| CCG46502.1 protein network | https://string-db.org/network/866895.HBHAL_4160 | Hypothetical protein. |
| CCG46503.1 protein network | https://string-db.org/network/866895.HBHAL_4161 | Hypothetical protein. |
| CCG46504.1 protein network | https://string-db.org/network/866895.HBHAL_4162 | Conserved hypothetical protein. |
| CCG46505.1 protein network | https://string-db.org/network/866895.HBHAL_4163 | Homolog to 1,4-dihydroxy-2-naphthoate polyprenyltransferase. |
| CCG46506.1 protein network | https://string-db.org/network/866895.HBHAL_4164 | IS200-type transposase. |
| CCG46507.1 protein network | https://string-db.org/network/866895.HBHAL_4165 | IS1341-type transposase. |
| CCG46508.1 protein network | https://string-db.org/network/866895.HBHAL_4166 | Hypothetical protein. |
| CCG46509.1 protein network | https://string-db.org/network/866895.HBHAL_4167 | HAD superfamily hydrolase. |
| CCG46510.1 protein network | https://string-db.org/network/866895.HBHAL_4168 | Hypothetical protein. |
| CCG46511.1 protein network | https://string-db.org/network/866895.HBHAL_4169 | Hypothetical protein. |
| ycsI protein network | https://string-db.org/network/866895.HBHAL_4170 | Hypothetical protein; Belongs to the D-glutamate cyclase family. |
| malL2 protein network | https://string-db.org/network/866895.HBHAL_4171 | Oligo-1,6-glucosidase. |
| CCG46514.1 protein network | https://string-db.org/network/866895.HBHAL_4172 | Hypothetical protein. |
| CCG46515.1 protein network | https://string-db.org/network/866895.HBHAL_4173 | Conserved hypothetical protein. |
| CCG46516.1 protein network | https://string-db.org/network/866895.HBHAL_4174 | Acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase. |
| atoA protein network | https://string-db.org/network/866895.HBHAL_4175 | CoA-transferase subunit B. |
| atoD protein network | https://string-db.org/network/866895.HBHAL_4176 | CoA-transferase subunit A. |
| CCG46519.1 protein network | https://string-db.org/network/866895.HBHAL_4177 | Aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. |
| CCG46520.1 protein network | https://string-db.org/network/866895.HBHAL_4178 | PucR family transcription regulator. |
| CCG46521.1 protein network | https://string-db.org/network/866895.HBHAL_4179 | Homolog to TcdC protein. |
| gtaB2 protein network | https://string-db.org/network/866895.HBHAL_4180 | UTP-glucose-1-phosphate uridylyltransferase. |
| purU protein network | https://string-db.org/network/866895.HBHAL_4181 | Formyltetrahydrofolate deformylase; Catalyzes the hydrolysis of 10-formyltetrahydrofolate (formyl-FH4) to formate and tetrahydrofolate (FH4). |
| CCG46524.1 protein network | https://string-db.org/network/866895.HBHAL_4182 | Acetyltransferase, GNAT family. |
| CCG46525.1 protein network | https://string-db.org/network/866895.HBHAL_4183 | IS231-type transposase. |
| CCG46526.1 protein network | https://string-db.org/network/866895.HBHAL_4184 | Hypothetical protein. |
| CCG46527.1 protein network | https://string-db.org/network/866895.HBHAL_4185 | gamma-DL-glutamyl hydrolase. |
| CCG46528.1 protein network | https://string-db.org/network/866895.HBHAL_4186 | 3-oxoacyl-[acyl carrier protein] reductase. |
| CCG46529.1 protein network | https://string-db.org/network/866895.HBHAL_4187 | Fumarylacetoacetase. |
| CCG46530.1 protein network | https://string-db.org/network/866895.HBHAL_4188 | TRAP-T type transporter. |
| CCG46531.1 protein network | https://string-db.org/network/866895.HBHAL_4189 | Hypothetical protein. |
| CCG46532.1 protein network | https://string-db.org/network/866895.HBHAL_4190 | Putative TRAP-T type transporter solute receptor. |
| CCG46533.1 protein network | https://string-db.org/network/866895.HBHAL_4191 | Two-component response regulator. |
| CCG46534.1 protein network | https://string-db.org/network/866895.HBHAL_4192 | Two-component sensor histidine kinase. |
| dctP3 protein network | https://string-db.org/network/866895.HBHAL_4193 | Probable TRAP-T type transporter subunit DctP. |
| CCG46536.1 protein network | https://string-db.org/network/866895.HBHAL_4194 | Hypothetical protein. |
| CCG46538.1 protein network | https://string-db.org/network/866895.HBHAL_4196 | FAD-dependent oxidoreductase. |
| CCG46539.1 protein network | https://string-db.org/network/866895.HBHAL_4197 | Conserved hypothetical protein. |
| glxK protein network | https://string-db.org/network/866895.HBHAL_4198 | Glycerate kinase; Belongs to the glycerate kinase type-1 family. |
| npr2 protein network | https://string-db.org/network/866895.HBHAL_4199 | Neutral protease; Extracellular zinc metalloprotease. |
| CCG46542.1 protein network | https://string-db.org/network/866895.HBHAL_4200 | Hypothetical protein. |
| CCG46543.1 protein network | https://string-db.org/network/866895.HBHAL_4201 | Conserved hypothetical protein. |
| CCG46544.1 protein network | https://string-db.org/network/866895.HBHAL_4202 | Aminoacylase. |
| CCG46545.1 protein network | https://string-db.org/network/866895.HBHAL_4203 | Hypothetical protein. |
| CCG46546.1 protein network | https://string-db.org/network/866895.HBHAL_4204 | 2,5-didehydrogluconate reductase. |
| CCG46547.1 protein network | https://string-db.org/network/866895.HBHAL_4205 | AsnC family transcription regulator. |
| CCG46548.1 protein network | https://string-db.org/network/866895.HBHAL_4206 | Aminotransferase. |
| pgdS protein network | https://string-db.org/network/866895.HBHAL_4207 | gamma-DL-glutamyl hydrolase. |
| CCG46550.1 protein network | https://string-db.org/network/866895.HBHAL_4208 | Hypothetical protein; Belongs to the sigma-70 factor family. |
| CCG46551.1 protein network | https://string-db.org/network/866895.HBHAL_4209 | Glycoside hydrolase, family 16. |
| CCG46552.1 protein network | https://string-db.org/network/866895.HBHAL_4210 | LacI family transcription regulator. |
| CCG46553.1 protein network | https://string-db.org/network/866895.HBHAL_4211 | Hypothetical protein. |
| bglA protein network | https://string-db.org/network/866895.HBHAL_4213 | Beta-glucosidase. |
| CCG46556.1 protein network | https://string-db.org/network/866895.HBHAL_4214 | ABC-type transport system permease protein (probable substrate sugar/cellobiose). |
| CCG46557.1 protein network | https://string-db.org/network/866895.HBHAL_4215 | ABC-type transport system permease protein (probable substrate sugar/cellobiose). |
| CCG46558.1 protein network | https://string-db.org/network/866895.HBHAL_4216 | ABC-type transport system extracellular binding protein (probable substrate sugar/cellobiose). |
| CCG46559.1 protein network | https://string-db.org/network/866895.HBHAL_4217 | LytR family transcription regulator. |
| CCG46560.1 protein network | https://string-db.org/network/866895.HBHAL_4218 | Conserved hypothetical protein. |
| CCG46561.1 protein network | https://string-db.org/network/866895.HBHAL_4219 | NADH:flavin oxidoreductase / NADH oxidase family protein. |
| CCG46562.1 protein network | https://string-db.org/network/866895.HBHAL_4220 | Conserved hypothetical protein. |
| CCG46563.1 protein network | https://string-db.org/network/866895.HBHAL_4221 | Hypothetical protein. |
| arsC protein network | https://string-db.org/network/866895.HBHAL_4222 | Arsenate reductase; Catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)]. |
| ydfA protein network | https://string-db.org/network/866895.HBHAL_4223 | Probable arsenical pump membrane protein YdfA; Involved in arsenical resistance. Thought to form the channel of an arsenite pump; Belongs to the ArsB family. |
| CCG46566.1 protein network | https://string-db.org/network/866895.HBHAL_4224 | ArsR family transcription regulator. |
| CCG46567.1 protein network | https://string-db.org/network/866895.HBHAL_4225 | Hypothetical protein. |
| CCG46568.1 protein network | https://string-db.org/network/866895.HBHAL_4226 | Hypothetical protein. |
| tgl protein network | https://string-db.org/network/866895.HBHAL_4227 | Transglutaminase. |
| CCG46570.1 protein network | https://string-db.org/network/866895.HBHAL_4228 | Hypothetical protein. |
| capE protein network | https://string-db.org/network/866895.HBHAL_4229 | PGA biosynthesis protein CapE. |
| capD1 protein network | https://string-db.org/network/866895.HBHAL_4230 | Capsule depolymerase CapD. |
| capA1 protein network | https://string-db.org/network/866895.HBHAL_4231 | PGA biosynthesis protein CapA. |
| capC1 protein network | https://string-db.org/network/866895.HBHAL_4232 | PGA biosynthesis protein CapC. |
| capB1 protein network | https://string-db.org/network/866895.HBHAL_4233 | PGA synthase CapB. |
| CCG46576.1 protein network | https://string-db.org/network/866895.HBHAL_4234 | Hypothetical protein. |
| CCG46577.1 protein network | https://string-db.org/network/866895.HBHAL_4235 | Hypothetical protein. |
| CCG46578.1 protein network | https://string-db.org/network/866895.HBHAL_4236 | CRP/FNR family transcription regulator. |
| CCG46579.1 protein network | https://string-db.org/network/866895.HBHAL_4237 | Hypothetical protein. |
| CCG46581.1 protein network | https://string-db.org/network/866895.HBHAL_4239 | ZIP family transporter (probable substrate divalent heavy-metal cations). |
| CCG46582.1 protein network | https://string-db.org/network/866895.HBHAL_4240 | Conserved hypothetical protein. |
| CCG46583.1 protein network | https://string-db.org/network/866895.HBHAL_4241 | Conserved hypothetical protein. |
| CCG46584.1 protein network | https://string-db.org/network/866895.HBHAL_4242 | Hypothetical protein. |
| CCG46585.1 protein network | https://string-db.org/network/866895.HBHAL_4243 | Hypothetical protein. |
| CCG46586.1 protein network | https://string-db.org/network/866895.HBHAL_4244 | Putative short-chain fatty acid transporter. |
| CCG46587.1 protein network | https://string-db.org/network/866895.HBHAL_4245 | Sporulation control protein. |
| CCG46588.1 protein network | https://string-db.org/network/866895.HBHAL_4246 | Hypothetical protein. |
| CCG46589.1 protein network | https://string-db.org/network/866895.HBHAL_4247 | GlnR/MerR family transcription regulator. |
| CCG46590.1 protein network | https://string-db.org/network/866895.HBHAL_4248 | Conserved hypothetical protein. |
| CCG46591.1 protein network | https://string-db.org/network/866895.HBHAL_4249 | Hypothetical protein. |
| CCG46592.1 protein network | https://string-db.org/network/866895.HBHAL_4250 | Hypothetical protein. |
| CCG46593.1 protein network | https://string-db.org/network/866895.HBHAL_4251 | Hypothetical protein. |
| CCG46594.1 protein network | https://string-db.org/network/866895.HBHAL_4252 | TetR family transcription regulator. |
| swrC protein network | https://string-db.org/network/866895.HBHAL_4253 | Swarming motility protein SwrC; Belongs to the resistance-nodulation-cell division (RND) (TC 2.A.6) family. |
| CCG46596.1 protein network | https://string-db.org/network/866895.HBHAL_4254 | Hypothetical protein. |
| CCG46597.1 protein network | https://string-db.org/network/866895.HBHAL_4255 | Conserved hypothetical protein. |
| CCG46598.1 protein network | https://string-db.org/network/866895.HBHAL_4256 | MFS-type transporter (probable sugar permease). |
| CCG46599.1 protein network | https://string-db.org/network/866895.HBHAL_4257 | Hypothetical protein. |
| CCG46600.1 protein network | https://string-db.org/network/866895.HBHAL_4258 | Hypothetical protein. |
| CCG46601.1 protein network | https://string-db.org/network/866895.HBHAL_4259 | Conserved hypothetical protein. |
| ldh2 protein network | https://string-db.org/network/866895.HBHAL_4261 | L-lactate dehydrogenase; Catalyzes the conversion of lactate to pyruvate. Belongs to the LDH/MDH superfamily. LDH family. |
| CCG46604.1 protein network | https://string-db.org/network/866895.HBHAL_4262 | L-lactate permease family transporter; Transports L-lactate across the membrane. Can also transport D-lactate and glycolate; Belongs to the lactate permease family. |
| CCG46605.1 protein network | https://string-db.org/network/866895.HBHAL_4263 | Hypothetical protein. |
| CCG46606.1 protein network | https://string-db.org/network/866895.HBHAL_4264 | Conserved hypothetical protein. |
| CCG46607.1 protein network | https://string-db.org/network/866895.HBHAL_4265 | Hypothetical protein. |
| CCG46608.1 protein network | https://string-db.org/network/866895.HBHAL_4266 | Hypothetical protein. |
| CCG46609.1 protein network | https://string-db.org/network/866895.HBHAL_4267 | Hypothetical protein. |
| CCG46610.1 protein network | https://string-db.org/network/866895.HBHAL_4268 | Hypothetical protein. |
| CCG46611.1 protein network | https://string-db.org/network/866895.HBHAL_4269 | Hypothetical protein. |
| CCG46613.1 protein network | https://string-db.org/network/866895.HBHAL_4271 | Conserved hypothetical protein. |
| CCG46614.1 protein network | https://string-db.org/network/866895.HBHAL_4273 | Hypothetical protein. |
| CCG46615.1 protein network | https://string-db.org/network/866895.HBHAL_4274 | Hypothetical protein. |
| CCG46616.1 protein network | https://string-db.org/network/866895.HBHAL_4275 | Monooxygenase, FAD-binding. |
| CCG46617.1 protein network | https://string-db.org/network/866895.HBHAL_4276 | AraC family transcription regulator. |
| CCG46618.1 protein network | https://string-db.org/network/866895.HBHAL_4277 | Hypothetical protein. |
| lcdH protein network | https://string-db.org/network/866895.HBHAL_4278 | 3-hydroxyacyl-CoA dehydrogenase; Catalyzes the NAD(+)-dependent oxidation of L-carnitine to 3- dehydrocarnitine. |
| CCG46620.1 protein network | https://string-db.org/network/866895.HBHAL_4279 | Hypothetical protein. |
| CCG46621.1 protein network | https://string-db.org/network/866895.HBHAL_4280 | TetR family transcription regulator. |
| CCG46622.1 protein network | https://string-db.org/network/866895.HBHAL_4281 | Putative polysaccharide deacetylase. |
| CCG46623.1 protein network | https://string-db.org/network/866895.HBHAL_4282 | Hypothetical protein. |
| CCG46624.1 protein network | https://string-db.org/network/866895.HBHAL_4283 | Hypothetical protein. |
| CCG46625.1 protein network | https://string-db.org/network/866895.HBHAL_4284 | Acetyltransferase, GNAT family. |
| CCG46626.1 protein network | https://string-db.org/network/866895.HBHAL_4285 | Hypothetical protein. |
| CCG46627.1 protein network | https://string-db.org/network/866895.HBHAL_4286 | Esterase. |
| CCG46628.1 protein network | https://string-db.org/network/866895.HBHAL_4287 | Hypothetical protein. |
| CCG46629.1 protein network | https://string-db.org/network/866895.HBHAL_4288 | Hypothetical protein. |
| CCG46630.1 protein network | https://string-db.org/network/866895.HBHAL_4289 | Hypothetical protein. |
| CCG46631.1 protein network | https://string-db.org/network/866895.HBHAL_4290 | Hypothetical protein. |
| CCG46632.1 protein network | https://string-db.org/network/866895.HBHAL_4291 | Hypothetical protein. |
| yflH protein network | https://string-db.org/network/866895.HBHAL_4292 | Hypothetical protein. |
| CCG46634.1 protein network | https://string-db.org/network/866895.HBHAL_4293 | Putative transporter. |
| CCG46635.1 protein network | https://string-db.org/network/866895.HBHAL_4294 | Hypothetical protein. |
| CCG46636.1 protein network | https://string-db.org/network/866895.HBHAL_4295 | Hypothetical protein. |
| CCG46637.1 protein network | https://string-db.org/network/866895.HBHAL_4296 | Hypothetical protein. |
| ywqN protein network | https://string-db.org/network/866895.HBHAL_4297 | Probable trp repressor-binding protein. |
| CCG46639.1 protein network | https://string-db.org/network/866895.HBHAL_4298 | Hypothetical protein. |
| CCG46640.1 protein network | https://string-db.org/network/866895.HBHAL_4299 | Hypothetical protein. |
| CCG46641.1 protein network | https://string-db.org/network/866895.HBHAL_4300 | Hypothetical protein. |
| CCG46643.1 protein network | https://string-db.org/network/866895.HBHAL_4302 | Hypothetical protein. |
| CCG46644.1 protein network | https://string-db.org/network/866895.HBHAL_4303 | PadR family transcription regulator. |
| CCG46645.1 protein network | https://string-db.org/network/866895.HBHAL_4304 | Hypothetical protein. |
| CCG46647.1 protein network | https://string-db.org/network/866895.HBHAL_4306 | Acetyltransferase, GNAT family. |
| CCG46648.1 protein network | https://string-db.org/network/866895.HBHAL_4307 | Penicillin-binding protein. |
| CCG46649.1 protein network | https://string-db.org/network/866895.HBHAL_4308 | Hypothetical protein. |
| gldA protein network | https://string-db.org/network/866895.HBHAL_4309 | Glycerol dehydrogenase. |
| CCG46651.1 protein network | https://string-db.org/network/866895.HBHAL_4310 | Hypothetical protein. |
| CCG46652.1 protein network | https://string-db.org/network/866895.HBHAL_4311 | Hypothetical protein. |
| CCG46653.1 protein network | https://string-db.org/network/866895.HBHAL_4312 | AraC effector binding domain protein. |
| CCG46654.1 protein network | https://string-db.org/network/866895.HBHAL_4313 | Trifolitoxin immunity domain protein. |
| CCG46655.1 protein network | https://string-db.org/network/866895.HBHAL_4314 | Hypothetical protein. |
| CCG46656.1 protein network | https://string-db.org/network/866895.HBHAL_4315 | ArsR family transcription regulator. |
| yveD protein network | https://string-db.org/network/866895.HBHAL_4316 | Hypothetical protein. |
| CCG46658.1 protein network | https://string-db.org/network/866895.HBHAL_4317 | PadR family transcription regulator. |
| ureD protein network | https://string-db.org/network/866895.HBHAL_4318 | Urease accessory protein UreD; Required for maturation of urease via the functional incorporation of the urease nickel metallocenter. |
| ureG protein network | https://string-db.org/network/866895.HBHAL_4319 | Urease accessory protein UreG; Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG. |
| ureF protein network | https://string-db.org/network/866895.HBHAL_4321 | Urease accessory protein UreF; Required for maturation of urease via the functional incorporation of the urease nickel metallocenter. |
| ureE protein network | https://string-db.org/network/866895.HBHAL_4322 | Urease accessory protein UreE; Involved in urease metallocenter assembly. Binds nickel. Probably functions as a nickel donor during metallocenter assembly. Belongs to the UreE family. |
| ureC protein network | https://string-db.org/network/866895.HBHAL_4323 | Urease alpha subunit. |
| ureB protein network | https://string-db.org/network/866895.HBHAL_4324 | Urease beta subunit; Belongs to the urease beta subunit family. |
| ureA protein network | https://string-db.org/network/866895.HBHAL_4325 | Urease gamma subunit; Belongs to the urease gamma subunit family. |
| CCG46667.1 protein network | https://string-db.org/network/866895.HBHAL_4326 | Hypothetical protein. |
| CCG46668.1 protein network | https://string-db.org/network/866895.HBHAL_4327 | Putative transporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| CCG46669.1 protein network | https://string-db.org/network/866895.HBHAL_4328 | ABC-type transport system permease protein (probable substrate iron complex); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily. |
| CCG46670.1 protein network | https://string-db.org/network/866895.HBHAL_4329 | ABC-type transport system ATP-binding protein (probable substrate iron complex). |
| CCG46671.1 protein network | https://string-db.org/network/866895.HBHAL_4330 | ABC-type transport system extracellular binding protein (probable substrate iron complex). |
| ydaF protein network | https://string-db.org/network/866895.HBHAL_4331 | Conserved hypothetical protein. |
| CCG46673.1 protein network | https://string-db.org/network/866895.HBHAL_4332 | DNA polymerase beta domain protein region. |
| CCG46674.1 protein network | https://string-db.org/network/866895.HBHAL_4333 | Ferroxidase; Iron-storage protein. |
| CCG46675.1 protein network | https://string-db.org/network/866895.HBHAL_4334 | Rubrerythrin family protein. |
| yxiS protein network | https://string-db.org/network/866895.HBHAL_4335 | Hypothetical protein. |
| ybaJ protein network | https://string-db.org/network/866895.HBHAL_4336 | Probable methyltransferase YbaJ. |
| CCG46678.1 protein network | https://string-db.org/network/866895.HBHAL_4337 | DUF21/CBS domain protein. |
| CCG46679.1 protein network | https://string-db.org/network/866895.HBHAL_4338 | DUF21/CBS domain protein. |
| CCG46680.1 protein network | https://string-db.org/network/866895.HBHAL_4339 | Putative sporulation control protein. |
| CCG46681.1 protein network | https://string-db.org/network/866895.HBHAL_4340 | Allantoate amidohydrolase. |
| CCG46682.1 protein network | https://string-db.org/network/866895.HBHAL_4341 | Hypothetical protein. |
| CCG46683.1 protein network | https://string-db.org/network/866895.HBHAL_4342 | Cell wall endopeptidase, family M23/M37. |
| CCG46684.1 protein network | https://string-db.org/network/866895.HBHAL_4343 | MtlR/BglG family transcription regulator. |
| CCG46685.1 protein network | https://string-db.org/network/866895.HBHAL_4344 | PTS system subunit IIB. |
| CCG46686.1 protein network | https://string-db.org/network/866895.HBHAL_4345 | PTS system subunit IIC. |
| CCG46687.1 protein network | https://string-db.org/network/866895.HBHAL_4346 | Hypothetical protein. |
| CCG46688.1 protein network | https://string-db.org/network/866895.HBHAL_4347 | Hypothetical protein. |
| CCG46689.1 protein network | https://string-db.org/network/866895.HBHAL_4348 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| catE protein network | https://string-db.org/network/866895.HBHAL_4350 | Catechol-2,3-dioxygenase. |
| CCG46692.1 protein network | https://string-db.org/network/866895.HBHAL_4351 | Hypothetical protein. |
| CCG46693.1 protein network | https://string-db.org/network/866895.HBHAL_4352 | Hypothetical protein. |
| CCG46694.1 protein network | https://string-db.org/network/866895.HBHAL_4353 | Conserved hypothetical protein. |
| CCG46695.1 protein network | https://string-db.org/network/866895.HBHAL_4354 | Short-chain dehydrogenase/reductase family protein. |
| CCG46696.1 protein network | https://string-db.org/network/866895.HBHAL_4355 | SSS family transporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| CCG46697.1 protein network | https://string-db.org/network/866895.HBHAL_4356 | Hypothetical protein. |
| CCG46698.1 protein network | https://string-db.org/network/866895.HBHAL_4357 | Phosphoglycerate mutase family protein. |
| CCG46700.1 protein network | https://string-db.org/network/866895.HBHAL_4359 | Hypothetical protein. |
| CCG46701.1 protein network | https://string-db.org/network/866895.HBHAL_4360 | Hypothetical protein. |
| CCG46702.1 protein network | https://string-db.org/network/866895.HBHAL_4361 | Hypothetical protein. |
| CCG46704.1 protein network | https://string-db.org/network/866895.HBHAL_4363 | Hypothetical protein. |
| CCG46705.1 protein network | https://string-db.org/network/866895.HBHAL_4364 | Hypothetical protein. |
| CCG46706.1 protein network | https://string-db.org/network/866895.HBHAL_4365 | Hypothetical protein. |
| CCG46708.1 protein network | https://string-db.org/network/866895.HBHAL_4367 | Hypothetical protein. |
| CCG46709.1 protein network | https://string-db.org/network/866895.HBHAL_4368 | Hypothetical protein. |
| CCG46710.1 protein network | https://string-db.org/network/866895.HBHAL_4369 | Alpha/beta fold hydrolase. |
| CCG46711.1 protein network | https://string-db.org/network/866895.HBHAL_4370 | Hypothetical protein. |
| CCG46712.1 protein network | https://string-db.org/network/866895.HBHAL_4371 | Hypothetical protein. |
| CCG46713.1 protein network | https://string-db.org/network/866895.HBHAL_4372 | Hypothetical protein. |
| CCG46714.1 protein network | https://string-db.org/network/866895.HBHAL_4373 | Hypothetical protein. |
| CCG46715.1 protein network | https://string-db.org/network/866895.HBHAL_4374 | Hypothetical protein. |
| CCG46716.1 protein network | https://string-db.org/network/866895.HBHAL_4375 | TetR family transcription regulator. |
| CCG46717.1 protein network | https://string-db.org/network/866895.HBHAL_4377 | MFS-type transporter. |
| CCG46718.1 protein network | https://string-db.org/network/866895.HBHAL_4378 | Hypothetical protein. |
| CCG46719.1 protein network | https://string-db.org/network/866895.HBHAL_4379 | Alcohol dehydrogenase. |
| CCG46720.1 protein network | https://string-db.org/network/866895.HBHAL_4380 | Hypothetical protein. |
| CCG46721.1 protein network | https://string-db.org/network/866895.HBHAL_4381 | Hypothetical protein. |
| ytxJ2 protein network | https://string-db.org/network/866895.HBHAL_4384 | Conserved hypothetical protein. |
| CCG46725.1 protein network | https://string-db.org/network/866895.HBHAL_4385 | Hypothetical protein. |
| CCG46726.1 protein network | https://string-db.org/network/866895.HBHAL_4386 | Hypothetical protein. |
| CCG46727.1 protein network | https://string-db.org/network/866895.HBHAL_4387 | Hypothetical protein. |
| srfJ protein network | https://string-db.org/network/866895.HBHAL_4388 | Glucosylceramidase; Belongs to the glycosyl hydrolase 30 family. |
| CCG46729.1 protein network | https://string-db.org/network/866895.HBHAL_4389 | ABC-type transport system permease protein (probable substrate sugar/cellobiose). |
| CCG46730.1 protein network | https://string-db.org/network/866895.HBHAL_4390 | ABC-type transport system permease protein (probable substrate sugar/cellobiose). |
| CCG46731.1 protein network | https://string-db.org/network/866895.HBHAL_4391 | ABC-type transport system extracellular binding protein (probable substrate sugar/cellobiose). |
| yesL protein network | https://string-db.org/network/866895.HBHAL_4392 | Hypothetical protein. |
| CCG46733.1 protein network | https://string-db.org/network/866895.HBHAL_4393 | LacI family transcription regulator. |
| CCG46734.1 protein network | https://string-db.org/network/866895.HBHAL_4394 | DnaD domain protein. |
| CCG46735.1 protein network | https://string-db.org/network/866895.HBHAL_4395 | Hypothetical protein. |
| HBHAL_4397 protein network | https://string-db.org/network/866895.HBHAL_4397 | Short-chain dehydrogenase/reductase family protein (nonfunctional). |
| CCG46738.1 protein network | https://string-db.org/network/866895.HBHAL_4398 | Hypothetical protein. |
| CCG46740.1 protein network | https://string-db.org/network/866895.HBHAL_4400 | FAD-dependent oxidoreductase. |
| CCG46741.1 protein network | https://string-db.org/network/866895.HBHAL_4401 | IS1341-type transposase. |
| CCG46742.1 protein network | https://string-db.org/network/866895.HBHAL_4402 | Hypothetical protein. |
| dctM1 protein network | https://string-db.org/network/866895.HBHAL_4403 | TRAP-T type transporter subunit DctM. |
| dctQ1 protein network | https://string-db.org/network/866895.HBHAL_4404 | TRAP-T type transporter subunit DctQ. |
| dctP1 protein network | https://string-db.org/network/866895.HBHAL_4405 | TRAP-T type transporter subunit DctP. |
| CCG46746.1 protein network | https://string-db.org/network/866895.HBHAL_4406 | GntR family transcription regulator. |
| CCG46747.1 protein network | https://string-db.org/network/866895.HBHAL_4407 | Hypothetical protein. |
| yckC4 protein network | https://string-db.org/network/866895.HBHAL_4408 | RDD domain protein. |
| yckC5 protein network | https://string-db.org/network/866895.HBHAL_4409 | RDD domain protein. |
| CCG46750.1 protein network | https://string-db.org/network/866895.HBHAL_4410 | Hypothetical protein. |
| CCG46751.1 protein network | https://string-db.org/network/866895.HBHAL_4411 | Hypothetical protein. |
| CCG46752.1 protein network | https://string-db.org/network/866895.HBHAL_4412 | Hypothetical protein. |
| CCG46753.1 protein network | https://string-db.org/network/866895.HBHAL_4413 | Hypothetical protein. |
| CCG46754.1 protein network | https://string-db.org/network/866895.HBHAL_4414 | Conserved hypothetical protein. |
| CCG46755.1 protein network | https://string-db.org/network/866895.HBHAL_4415 | Hypothetical protein. |
| CCG46756.1 protein network | https://string-db.org/network/866895.HBHAL_4416 | Hypothetical protein. |
| CCG46757.1 protein network | https://string-db.org/network/866895.HBHAL_4417 | Acyltransferase 3. |
| CCG46758.1 protein network | https://string-db.org/network/866895.HBHAL_4418 | Acyltransferase family protein. |
| CCG46759.1 protein network | https://string-db.org/network/866895.HBHAL_4419 | Putative polysaccharide polymerase. |
| sat2 protein network | https://string-db.org/network/866895.HBHAL_4420 | Sulfate adenylyltransferase; Belongs to the sulfate adenylyltransferase family. |
| cysQ protein network | https://string-db.org/network/866895.HBHAL_4421 | 3'(2'),5'-bisphosphate nucleotidase; Converts adenosine-3',5'-bisphosphate (PAP) to AMP. Belongs to the inositol monophosphatase superfamily. CysQ family. |
| cysC2 protein network | https://string-db.org/network/866895.HBHAL_4422 | Adenylylsulfate kinase; Catalyzes the synthesis of activated sulfate. |
| sac1 protein network | https://string-db.org/network/866895.HBHAL_4423 | TrkA-C domain protein. |
| CCG46764.1 protein network | https://string-db.org/network/866895.HBHAL_4424 | Group 1 glycosyltransferase. |
| CCG46765.1 protein network | https://string-db.org/network/866895.HBHAL_4425 | Conserved hypothetical protein. |
| CCG46766.1 protein network | https://string-db.org/network/866895.HBHAL_4426 | UDP-N-acetyl-D-mannosamine dehydrogenase; Belongs to the UDP-glucose/GDP-mannose dehydrogenase family. |
| CCG46767.1 protein network | https://string-db.org/network/866895.HBHAL_4427 | Hypothetical protein. |
| CCG46768.1 protein network | https://string-db.org/network/866895.HBHAL_4428 | Sulfotransferase. |
| CCG46769.1 protein network | https://string-db.org/network/866895.HBHAL_4429 | Hypothetical protein. |
| CCG46770.1 protein network | https://string-db.org/network/866895.HBHAL_4430 | Group 1 glycosyltransferase. |
| CCG46771.1 protein network | https://string-db.org/network/866895.HBHAL_4431 | O-antigen translocase. |
| galE4 protein network | https://string-db.org/network/866895.HBHAL_4432 | UDP-glucose 4-epimerase. |
| tuaA protein network | https://string-db.org/network/866895.HBHAL_4433 | TuaA. |
| CCG46774.1 protein network | https://string-db.org/network/866895.HBHAL_4434 | Capsular polysaccharide biosynthesis protein,putative protein-tyrosine phosphatase. |
| CCG46775.1 protein network | https://string-db.org/network/866895.HBHAL_4435 | Capsular polysaccharide biosynthesis protein,putative tyrosine-protein kinase. |
| CCG46776.1 protein network | https://string-db.org/network/866895.HBHAL_4436 | Capsular polysaccharide biosynthesis protein,putative chain length regulator. |
| CCG46777.1 protein network | https://string-db.org/network/866895.HBHAL_4437 | Hypothetical protein. |
| CCG46778.1 protein network | https://string-db.org/network/866895.HBHAL_4438 | Conserved hypothetical protein. |
| CCG46779.1 protein network | https://string-db.org/network/866895.HBHAL_4439 | Hypothetical protein. |
| CCG46780.1 protein network | https://string-db.org/network/866895.HBHAL_4440 | Hypothetical protein. |
| prtB protein network | https://string-db.org/network/866895.HBHAL_4441 | S8/S53 family peptidase; Belongs to the peptidase S8 family. |
| secA2 protein network | https://string-db.org/network/866895.HBHAL_4442 | Preprotein translocase subunit SecA; Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to [...] |
| CCG46783.1 protein network | https://string-db.org/network/866895.HBHAL_4443 | Hypothetical protein. |
| CCG46784.1 protein network | https://string-db.org/network/866895.HBHAL_4444 | Alkaline serine protease, subtilase family; Belongs to the peptidase S8 family. |
| CCG46785.1 protein network | https://string-db.org/network/866895.HBHAL_4445 | Putative S-layer protein. |
| CCG46786.1 protein network | https://string-db.org/network/866895.HBHAL_4446 | Hypothetical protein. |
| CCG46787.1 protein network | https://string-db.org/network/866895.HBHAL_4447 | 5'-nucleotidase precursor; Belongs to the 5'-nucleotidase family. |
| CCG46789.1 protein network | https://string-db.org/network/866895.HBHAL_4449 | Extracellular alkaline serine protease. |
| CCG46790.1 protein network | https://string-db.org/network/866895.HBHAL_4450 | Probable N-acetylmuramoyl-L-alanine amidase. |
| CCG46791.1 protein network | https://string-db.org/network/866895.HBHAL_4451 | S-layer protein / peptidoglycan endo-beta-N-acetylglucosaminidase. |
| CCG46792.1 protein network | https://string-db.org/network/866895.HBHAL_4452 | Putative teichoic acid biosynthesis protein A; Catalyzes the conversion of GlcNAc-PP-undecaprenol into ManNAc-GlcNAc-PP-undecaprenol, the first committed lipid intermediate in the de novo synthes [...] |
| CCG46793.1 protein network | https://string-db.org/network/866895.HBHAL_4453 | Polysaccharide biosynthesis protein. |
| CCG46794.1 protein network | https://string-db.org/network/866895.HBHAL_4454 | Conserved hypothetical protein. |
| CCG46795.1 protein network | https://string-db.org/network/866895.HBHAL_4455 | Polysaccharide pyruvyl transferase. |
| CCG46796.1 protein network | https://string-db.org/network/866895.HBHAL_4456 | Hypothetical protein. |
| CCG46797.1 protein network | https://string-db.org/network/866895.HBHAL_4457 | Methyl-accepting chemotaxis protein. |
| CCG46798.1 protein network | https://string-db.org/network/866895.HBHAL_4458 | Hypothetical protein. |
| CCG46799.1 protein network | https://string-db.org/network/866895.HBHAL_4459 | Hypothetical protein. |
| CCG46801.1 protein network | https://string-db.org/network/866895.HBHAL_4461 | Hypothetical protein. |
| CCG46802.1 protein network | https://string-db.org/network/866895.HBHAL_4462 | Hypothetical protein. |
| CCG46803.1 protein network | https://string-db.org/network/866895.HBHAL_4463 | BNR repeat domain protein. |
| copZ2 protein network | https://string-db.org/network/866895.HBHAL_4464 | Copper chaperone CopZ. |
| CCG46805.1 protein network | https://string-db.org/network/866895.HBHAL_4465 | Conserved hypothetical protein. |
| CCG46806.1 protein network | https://string-db.org/network/866895.HBHAL_4466 | Hypothetical protein. |
| CCG46807.1 protein network | https://string-db.org/network/866895.HBHAL_4467 | Hypothetical protein. |
| CCG46808.1 protein network | https://string-db.org/network/866895.HBHAL_4468 | Glycosyltransferase WecB/TagA/CpsF family; Catalyzes the conversion of GlcNAc-PP-undecaprenol into ManNAc-GlcNAc-PP-undecaprenol, the first committed lipid intermediate in the de novo synthesis o [...] |
| CCG46809.1 protein network | https://string-db.org/network/866895.HBHAL_4469 | UDP-glucose/GDP-mannose dehydrogenase; Belongs to the UDP-glucose/GDP-mannose dehydrogenase family. |
| CCG46810.1 protein network | https://string-db.org/network/866895.HBHAL_4470 | Hypothetical protein. |
| mviN protein network | https://string-db.org/network/866895.HBHAL_4471 | Integral membrane protein MviN; Involved in peptidoglycan biosynthesis. Transports lipid- linked peptidoglycan precursors from the inner to the outer leaflet of the cytoplasmic membrane. |
| CCG46812.1 protein network | https://string-db.org/network/866895.HBHAL_4472 | Group 1 glycosyltransferase. |
| CCG46813.1 protein network | https://string-db.org/network/866895.HBHAL_4473 | Hypothetical protein. |
| CCG46814.1 protein network | https://string-db.org/network/866895.HBHAL_4474 | Hypothetical protein. |
| CCG46815.1 protein network | https://string-db.org/network/866895.HBHAL_4475 | Hypothetical protein. |
| CCG46816.1 protein network | https://string-db.org/network/866895.HBHAL_4476 | Hypothetical protein. |
| CCG46817.1 protein network | https://string-db.org/network/866895.HBHAL_4477 | Hypothetical protein. |
| CCG46818.1 protein network | https://string-db.org/network/866895.HBHAL_4478 | Hypothetical protein. |
| CCG46819.1 protein network | https://string-db.org/network/866895.HBHAL_4479 | Amidohydrolase family protein. |
| CCG46820.1 protein network | https://string-db.org/network/866895.HBHAL_4480 | Hypothetical protein. |
| CCG46821.1 protein network | https://string-db.org/network/866895.HBHAL_4481 | Chromate transporter. |
| CCG46822.1 protein network | https://string-db.org/network/866895.HBHAL_4482 | PadR family transcription regulator. |
| CCG46823.1 protein network | https://string-db.org/network/866895.HBHAL_4483 | MFS-type transporter. |
| tagO2 protein network | https://string-db.org/network/866895.HBHAL_4485 | Probable undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase. |
| CCG46827.1 protein network | https://string-db.org/network/866895.HBHAL_4487 | Hypothetical protein. |
| CCG46828.1 protein network | https://string-db.org/network/866895.HBHAL_4488 | Hypothetical protein. |
| CCG46829.1 protein network | https://string-db.org/network/866895.HBHAL_4489 | SinR/xre family transcription regulator. |
| CCG46830.1 protein network | https://string-db.org/network/866895.HBHAL_4490 | Hypothetical protein. |
| CCG46831.1 protein network | https://string-db.org/network/866895.HBHAL_4491 | AraC family transcription regulator. |
| CCG46832.1 protein network | https://string-db.org/network/866895.HBHAL_4492 | Hypothetical protein. |
| CCG46833.1 protein network | https://string-db.org/network/866895.HBHAL_4493 | Conserved hypothetical protein. |
| CCG46834.1 protein network | https://string-db.org/network/866895.HBHAL_4494 | Phosphoglucomutase/phosphomannomutase family protein. |
| CCG46835.1 protein network | https://string-db.org/network/866895.HBHAL_4495 | Mannose-6-phosphate isomerase; Belongs to the mannose-6-phosphate isomerase type 1 family. |
| CCG46836.1 protein network | https://string-db.org/network/866895.HBHAL_4496 | PTS system subunit IIABC, sucrose-specific. |
| CCG46837.1 protein network | https://string-db.org/network/866895.HBHAL_4497 | LacI family transcription regulator. |
| CCG46838.1 protein network | https://string-db.org/network/866895.HBHAL_4498 | Hypothetical protein. |
| hom1 protein network | https://string-db.org/network/866895.HBHAL_4499 | Homoserine dehydrogenase. |
| thrC2 protein network | https://string-db.org/network/866895.HBHAL_4500 | Threonine synthase; Catalyzes the gamma-elimination of phosphate from L- phosphohomoserine and the beta-addition of water to produce L- threonine. |
| thrB protein network | https://string-db.org/network/866895.HBHAL_4501 | Homoserine kinase; Catalyzes the ATP-dependent phosphorylation of L-homoserine to L-homoserine phosphate; Belongs to the GHMP kinase family. Homoserine kinase subfamily. |
| CCG46842.1 protein network | https://string-db.org/network/866895.HBHAL_4502 | Hypothetical protein. |
| CCG46843.1 protein network | https://string-db.org/network/866895.HBHAL_4503 | Hypothetical protein. |
| CCG46844.1 protein network | https://string-db.org/network/866895.HBHAL_4504 | Hypothetical protein. |
| CCG46845.1 protein network | https://string-db.org/network/866895.HBHAL_4505 | Hypothetical protein; Belongs to the sigma-70 factor family. ECF subfamily. |
| CCG46846.1 protein network | https://string-db.org/network/866895.HBHAL_4506 | Hypothetical protein. |
| CCG46847.1 protein network | https://string-db.org/network/866895.HBHAL_4507 | Hypothetical protein. |
| CCG46848.1 protein network | https://string-db.org/network/866895.HBHAL_4508 | Hypothetical protein. |
| CCG46849.1 protein network | https://string-db.org/network/866895.HBHAL_4509 | Probable transport protein. |
| CCG46850.1 protein network | https://string-db.org/network/866895.HBHAL_4510 | DUF1568 family protein. |
| gnd protein network | https://string-db.org/network/866895.HBHAL_4511 | 6-phosphogluconate dehydrogenase-like protein. |
| CCG46852.1 protein network | https://string-db.org/network/866895.HBHAL_4512 | RpiR family transcription regulator. |
| CCG46853.1 protein network | https://string-db.org/network/866895.HBHAL_4513 | SSS family transporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| CCG46854.1 protein network | https://string-db.org/network/866895.HBHAL_4514 | Conserved hypothetical protein. |
| CCG46855.1 protein network | https://string-db.org/network/866895.HBHAL_4515 | Hypothetical protein. |
| CCG46856.1 protein network | https://string-db.org/network/866895.HBHAL_4516 | M15 family peptidase. |
| CCG46857.1 protein network | https://string-db.org/network/866895.HBHAL_4517 | Hypothetical protein. |
| CCG46858.1 protein network | https://string-db.org/network/866895.HBHAL_4518 | Glycoside hydrolase, family 2, sugar binding; Belongs to the glycosyl hydrolase 2 family. |
| CCG46859.1 protein network | https://string-db.org/network/866895.HBHAL_4519 | Sodium/galactoside symporter family protein. |
| CCG46860.1 protein network | https://string-db.org/network/866895.HBHAL_4520 | ArsR family transcription regulator. |
| CCG46862.1 protein network | https://string-db.org/network/866895.HBHAL_4522 | Bile acid/sodium symporter (BASS) family protein. |
| glcD2 protein network | https://string-db.org/network/866895.HBHAL_4523 | Glycolate oxidase subunit GlcD. |
| CCG46864.1 protein network | https://string-db.org/network/866895.HBHAL_4524 | Conserved hypothetical protein. |
| frnE protein network | https://string-db.org/network/866895.HBHAL_4525 | FrnE protein. |
| glcF protein network | https://string-db.org/network/866895.HBHAL_4526 | Glycolate oxidase iron-sulfur subunit. |
| glcD1 protein network | https://string-db.org/network/866895.HBHAL_4527 | Glycolate oxidase subunit GlcD. |
| npr3 protein network | https://string-db.org/network/866895.HBHAL_4528 | Neutral protease; Extracellular zinc metalloprotease. |
| lacZ protein network | https://string-db.org/network/866895.HBHAL_4531 | Beta-galactosidase. |
| CCG46870.1 protein network | https://string-db.org/network/866895.HBHAL_4532 | Conserved hypothetical protein. |
| galT protein network | https://string-db.org/network/866895.HBHAL_4533 | Galactose-1-phosphate uridylyltransferase. |
| galE3 protein network | https://string-db.org/network/866895.HBHAL_4534 | UDP-glucose 4-epimerase; Belongs to the NAD(P)-dependent epimerase/dehydratase family. |
| galK protein network | https://string-db.org/network/866895.HBHAL_4535 | Galactokinase; Catalyzes the transfer of the gamma-phosphate of ATP to D- galactose to form alpha-D-galactose-1-phosphate (Gal-1-P). Belongs to the GHMP kinase family. GalK subfamily. |
| aga protein network | https://string-db.org/network/866895.HBHAL_4536 | Alpha-galactosidase. |
| CCG46875.1 protein network | https://string-db.org/network/866895.HBHAL_4537 | ABC-type transport system permease protein (probable substrate sugar/lactose/L-arabinose). |
| CCG46876.1 protein network | https://string-db.org/network/866895.HBHAL_4538 | ABC-type transport system permease protein (probable substrate sugar/lactose/L-arabinose). |
| CCG46877.1 protein network | https://string-db.org/network/866895.HBHAL_4539 | ABC-type transport system extracellular binding protein (probable substrate sugar/lactose/L-arabinose). |
| CCG46878.1 protein network | https://string-db.org/network/866895.HBHAL_4540 | ROK family protein. |
| CCG46879.1 protein network | https://string-db.org/network/866895.HBHAL_4541 | Hypothetical protein. |
| CCG46880.1 protein network | https://string-db.org/network/866895.HBHAL_4542 | ROK family protein. |
| CCG46881.1 protein network | https://string-db.org/network/866895.HBHAL_4543 | LytR family transcription regulator. |
| CCG46882.1 protein network | https://string-db.org/network/866895.HBHAL_4544 | Small membrane protein. |
| CCG46883.1 protein network | https://string-db.org/network/866895.HBHAL_4545 | Hypothetical protein. |
| CCG46884.1 protein network | https://string-db.org/network/866895.HBHAL_4546 | Cytosolic long-chain acyl-CoA thioester hydrolase family protein. |
| CCG46885.1 protein network | https://string-db.org/network/866895.HBHAL_4547 | LysR family transcription regulator; Belongs to the LysR transcriptional regulatory family. |
| CCG46886.1 protein network | https://string-db.org/network/866895.HBHAL_4548 | Cation transporter. |
| CCG46887.1 protein network | https://string-db.org/network/866895.HBHAL_4549 | Group 2 glycosyltransferase. |
| CCG46888.1 protein network | https://string-db.org/network/866895.HBHAL_4550 | Conserved hypothetical protein. |
| CCG46889.1 protein network | https://string-db.org/network/866895.HBHAL_4551 | Conserved hypothetical protein. |
| CCG46890.1 protein network | https://string-db.org/network/866895.HBHAL_4552 | Probable permease. |
| CCG46891.1 protein network | https://string-db.org/network/866895.HBHAL_4553 | Hypothetical protein. |
| CCG46892.1 protein network | https://string-db.org/network/866895.HBHAL_4554 | Hypothetical protein. |
| CCG46893.1 protein network | https://string-db.org/network/866895.HBHAL_4555 | Oxidoreductase domain protein. |
| CCG46894.1 protein network | https://string-db.org/network/866895.HBHAL_4556 | Oxidoreductase domain protein. |
| CCG46895.1 protein network | https://string-db.org/network/866895.HBHAL_4557 | Hypothetical protein. |
| CCG46896.1 protein network | https://string-db.org/network/866895.HBHAL_4558 | LacI family transcription regulator. |
| CCG46897.1 protein network | https://string-db.org/network/866895.HBHAL_4559 | ABC-type transport system permease protein (probable substrate sugar). |
| CCG46898.1 protein network | https://string-db.org/network/866895.HBHAL_4560 | ABC-type transport system permease protein (probable substrate sugar). |
| CCG46899.1 protein network | https://string-db.org/network/866895.HBHAL_4561 | ABC-type transport system extracellular binding protein (probable substrate sugar). |
| ibpA protein network | https://string-db.org/network/866895.HBHAL_4562 | Small heat shock protein; Belongs to the small heat shock protein (HSP20) family. |
| CCG46901.1 protein network | https://string-db.org/network/866895.HBHAL_4563 | Hypothetical protein. |
| CCG46902.1 protein network | https://string-db.org/network/866895.HBHAL_4564 | Hypothetical protein. |
| CCG46903.1 protein network | https://string-db.org/network/866895.HBHAL_4565 | Hypothetical protein. |
| CCG46904.1 protein network | https://string-db.org/network/866895.HBHAL_4566 | Hypothetical protein. |
| CCG46905.1 protein network | https://string-db.org/network/866895.HBHAL_4567 | Hypothetical protein. |
| CCG46906.1 protein network | https://string-db.org/network/866895.HBHAL_4569 | Hypothetical protein. |
| CCG46907.1 protein network | https://string-db.org/network/866895.HBHAL_4569_A | Hypothetical protein. |
| CCG46908.1 protein network | https://string-db.org/network/866895.HBHAL_4570 | Xylose isomerase domain protein. |
| CCG46909.1 protein network | https://string-db.org/network/866895.HBHAL_4571 | SinR/xre family transcription regulator. |
| CCG46910.1 protein network | https://string-db.org/network/866895.HBHAL_4572 | CBS domain protein. |
| CCG46911.1 protein network | https://string-db.org/network/866895.HBHAL_4573 | ABC-type transport system ATP-binding/permease protein. |
| CCG46912.1 protein network | https://string-db.org/network/866895.HBHAL_4574 | Hypothetical protein. |
| CCG46913.1 protein network | https://string-db.org/network/866895.HBHAL_4575 | Peptidase C60 sortase A and B. |
| CCG46914.1 protein network | https://string-db.org/network/866895.HBHAL_4576 | Hypothetical protein. |
| acrB protein network | https://string-db.org/network/866895.HBHAL_4577 | Acriflavin resistance protein family transporter subunit AcrB; Belongs to the resistance-nodulation-cell division (RND) (TC 2.A.6) family. |
| acrA protein network | https://string-db.org/network/866895.HBHAL_4578 | Acriflavin resistance protein family transporter subunit AcrA; Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family. |
| CCG46917.1 protein network | https://string-db.org/network/866895.HBHAL_4579 | Hypothetical protein. |
| CCG46918.1 protein network | https://string-db.org/network/866895.HBHAL_4580 | Hypothetical protein. |
| CCG46919.1 protein network | https://string-db.org/network/866895.HBHAL_4581 | Subtilisin-like serine protease. |
| fabZ protein network | https://string-db.org/network/866895.HBHAL_4582 | (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase; Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated [...] |
| CCG46921.1 protein network | https://string-db.org/network/866895.HBHAL_4583 | Conserved hypothetical protein. |
| CCG46922.1 protein network | https://string-db.org/network/866895.HBHAL_4584 | FAD-dependent oxidoreductase. |
| CCG46923.1 protein network | https://string-db.org/network/866895.HBHAL_4585 | Hypothetical protein. |
| flhP protein network | https://string-db.org/network/866895.HBHAL_4586 | Flagellar hook-basal body protein. |
| flhO protein network | https://string-db.org/network/866895.HBHAL_4587 | Flagellar basal body rod protein. |
| mbl protein network | https://string-db.org/network/866895.HBHAL_4588 | Rod shape-determining protein Mbl. |
| CCG46927.1 protein network | https://string-db.org/network/866895.HBHAL_4589 | Stage III sporulation protein D. |
| spoIIQ protein network | https://string-db.org/network/866895.HBHAL_4590 | Stage II sporulation protein SpoIIQ. |
| CCG46929.1 protein network | https://string-db.org/network/866895.HBHAL_4591 | Stage II sporulation protein D. |
| murA1 protein network | https://string-db.org/network/866895.HBHAL_4592 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Cell wall formation. Adds enolpyruvyl to UDP-N- acetylglucosamine; Belongs to the EPSP synthase family. MurA subfamily. |
| ywmB protein network | https://string-db.org/network/866895.HBHAL_4593 | Hypothetical protein. |
| CCG46932.1 protein network | https://string-db.org/network/866895.HBHAL_4594 | Hypothetical protein. |
| atpC protein network | https://string-db.org/network/866895.HBHAL_4595 | F0F1 ATP synthase epsilon subunit; Produces ATP from ADP in the presence of a proton gradient across the membrane. |
| atpD protein network | https://string-db.org/network/866895.HBHAL_4596 | F0F1 ATP synthase beta subunit; Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits; Belongs to the ATPas [...] |
| atpG protein network | https://string-db.org/network/866895.HBHAL_4597 | F0F1 ATP synthase gamma subunit; Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the [...] |
| atpA protein network | https://string-db.org/network/866895.HBHAL_4598 | F0F1 ATP synthase alpha subunit; Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit. Belongs to the ATPase alpha/beta chains f [...] |
| atpH protein network | https://string-db.org/network/866895.HBHAL_4599 | F0F1 ATP synthase delta subunit; F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the [...] |
| atpF protein network | https://string-db.org/network/866895.HBHAL_4600 | F0F1 ATP synthase subunit B; Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0); Belongs to the ATPase B chain family. |
| atpE protein network | https://string-db.org/network/866895.HBHAL_4601 | F0F1 ATP synthase subunit C; F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extr [...] |
| atpB protein network | https://string-db.org/network/866895.HBHAL_4602 | F0F1 ATP synthase subunit A; Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. |
| atpI protein network | https://string-db.org/network/866895.HBHAL_4603 | F0F1 ATP synthase subunit I. |
| CCG46942.1 protein network | https://string-db.org/network/866895.HBHAL_4604 | Hypothetical protein. |
| vpr protein network | https://string-db.org/network/866895.HBHAL_4605 | Minor extracellular serine protease; Belongs to the peptidase S8 family. |
| mnaA protein network | https://string-db.org/network/866895.HBHAL_4606 | UDP-N-acetylglucosamine 2-epimerase; Belongs to the UDP-N-acetylglucosamine 2-epimerase family. |
| upp protein network | https://string-db.org/network/866895.HBHAL_4607 | Uracil phosphoribosyltransferase; Catalyzes the conversion of uracil and 5-phospho-alpha-D- ribose 1-diphosphate (PRPP) to UMP and diphosphate. |
| CCG46946.1 protein network | https://string-db.org/network/866895.HBHAL_4608 | Hypothetical protein. |
| glyA protein network | https://string-db.org/network/866895.HBHAL_4609 | Serine hydroxymethyltransferase; Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major so [...] |
| ywlG protein network | https://string-db.org/network/866895.HBHAL_4610 | Hypothetical protein; Belongs to the UPF0340 family. |
| ywlF protein network | https://string-db.org/network/866895.HBHAL_4611 | Ribose-5-phosphate isomerase. |
| ywlE protein network | https://string-db.org/network/866895.HBHAL_4612 | Protein-tyrosine-phosphatase; Belongs to the low molecular weight phosphotyrosine protein phosphatase family. |
| CCG46951.1 protein network | https://string-db.org/network/866895.HBHAL_4613 | Hypothetical protein; Probably functions as a manganese efflux pump. |
| CCG46952.1 protein network | https://string-db.org/network/866895.HBHAL_4614 | tRNA threonylcarbamoyladenosine biosynthesis protein; Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenin [...] |
| CCG46953.1 protein network | https://string-db.org/network/866895.HBHAL_4615 | Hypothetical protein. |
| CCG46954.1 protein network | https://string-db.org/network/866895.HBHAL_4616 | Stage II sporulation protein R. |
| prmC protein network | https://string-db.org/network/866895.HBHAL_4617 | Protoporphyrinogen oxidase; Methylates the class 1 translation termination release factors RF1/PrfA and RF2/PrfB on the glutamine residue of the universally conserved GGQ motif; Belongs to the pr [...] |
| prfA protein network | https://string-db.org/network/866895.HBHAL_4618 | Peptide chain release factor RF1; Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA. |
| CCG46957.1 protein network | https://string-db.org/network/866895.HBHAL_4619 | Hypothetical protein. |
| CCG46958.1 protein network | https://string-db.org/network/866895.HBHAL_4620 | Hypothetical protein. |
| CCG46959.1 protein network | https://string-db.org/network/866895.HBHAL_4621 | Hypothetical protein. |
| CCG46960.1 protein network | https://string-db.org/network/866895.HBHAL_4622 | Hypothetical protein. |
| tdk protein network | https://string-db.org/network/866895.HBHAL_4623 | Thymidine kinase. |
| CCG46962.1 protein network | https://string-db.org/network/866895.HBHAL_4624 | Hypothetical protein. |
| rpmE protein network | https://string-db.org/network/866895.HBHAL_4625 | 50S ribosomal protein L31 type B. |
| rho protein network | https://string-db.org/network/866895.HBHAL_4626 | Transcription termination factor Rho; Facilitates transcription termination by a mechanism that involves Rho binding to the nascent RNA, activation of Rho's RNA- dependent ATPase activity, and re [...] |
| CCG46965.1 protein network | https://string-db.org/network/866895.HBHAL_4627 | Hypothetical protein. |
| murA2 protein network | https://string-db.org/network/866895.HBHAL_4628 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Cell wall formation. Adds enolpyruvyl to UDP-N- acetylglucosamine; Belongs to the EPSP synthase family. MurA subfamily. |
| tal protein network | https://string-db.org/network/866895.HBHAL_4629 | Putative translaldolase; Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway; Belongs to the transaldolase family. Type 3B subfamily. |
| fbaA protein network | https://string-db.org/network/866895.HBHAL_4630 | Fructose 1,6-bisphosphate aldolase. |
| CCG46969.1 protein network | https://string-db.org/network/866895.HBHAL_4631 | Two-component response regulator. |
| pyrG protein network | https://string-db.org/network/866895.HBHAL_4633 | CTP synthetase; Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen. Regulates intracellular CTP levels through interactions with the [...] |
| rpoE protein network | https://string-db.org/network/866895.HBHAL_4634 | DNA-directed RNA polymerase delta subunit; Participates in both the initiation and recycling phases of transcription. In the presence of the delta subunit, RNAP displays an increased specificity [...] |
| mcm1 protein network | https://string-db.org/network/866895.HBHAL_4636 | methylmalonyl-CoA mutase; Catalyzes the reversible interconversion of isobutyryl-CoA and n-butyryl-CoA, using radical chemistry. Also exhibits GTPase activity, associated with its G-protein domai [...] |
| CCG46975.1 protein network | https://string-db.org/network/866895.HBHAL_4637 | TetR family transcription regulator. |
| CCG46976.1 protein network | https://string-db.org/network/866895.HBHAL_4638 | LAO/AO-type transport system ATPase. |
| CCG46977.1 protein network | https://string-db.org/network/866895.HBHAL_4639 | acyl-CoA dehydrogenase. |
| CCG46978.1 protein network | https://string-db.org/network/866895.HBHAL_4640 | acyl-CoA dehydrogenase. |
| hbd protein network | https://string-db.org/network/866895.HBHAL_4641 | 3-hydroxybutyryl-CoA dehydrogenase. |
| CCG46980.1 protein network | https://string-db.org/network/866895.HBHAL_4642 | acetyl-CoA acetyltransferase; Belongs to the thiolase-like superfamily. Thiolase family. |
| CCG46981.1 protein network | https://string-db.org/network/866895.HBHAL_4643 | Ferredoxin, 4Fe-4S. |
| cls3 protein network | https://string-db.org/network/866895.HBHAL_4644 | Homolog to cardiolipin synthetase; Belongs to the phospholipase D family. Cardiolipin synthase subfamily. |
| CCG46983.1 protein network | https://string-db.org/network/866895.HBHAL_4645 | Hypothetical protein. |
| argS2 protein network | https://string-db.org/network/866895.HBHAL_4646 | arginyl-tRNA synthetase. |
| CCG46985.1 protein network | https://string-db.org/network/866895.HBHAL_4647 | Conserved hypothetical protein. |
| CCG46986.1 protein network | https://string-db.org/network/866895.HBHAL_4648 | Hypothetical protein. |
| speB protein network | https://string-db.org/network/866895.HBHAL_4649 | Agmatinase; Belongs to the arginase family. |
| speE2 protein network | https://string-db.org/network/866895.HBHAL_4650 | Spermidine synthase; Catalyzes the irreversible transfer of a propylamine group from the amino donor S-adenosylmethioninamine (decarboxy-AdoMet) to putrescine (1,4-diaminobutane) to yield spermid [...] |
| pbpG protein network | https://string-db.org/network/866895.HBHAL_4651 | Penicillin binding protein 2D. |
| CCG46990.1 protein network | https://string-db.org/network/866895.HBHAL_4652 | Hypothetical protein. |
| ywhD protein network | https://string-db.org/network/866895.HBHAL_4653 | Hypothetical protein. |
| CCG46992.1 protein network | https://string-db.org/network/866895.HBHAL_4654 | ABC-type transport system permease protein. |
| ywgA protein network | https://string-db.org/network/866895.HBHAL_4655 | Conserved hypothetical protein. |
| CCG46994.1 protein network | https://string-db.org/network/866895.HBHAL_4656 | Conserved hypothetical protein. |
| lipL protein network | https://string-db.org/network/866895.HBHAL_4657 | Putative lipoate-protein ligase A; Catalyzes the amidotransfer (transamidation) of the octanoyl moiety from octanoyl-GcvH to the lipoyl domain of the E2 subunit of lipoate-dependent enzymes; Belo [...] |
| eutD protein network | https://string-db.org/network/866895.HBHAL_4658 | Phosphate acetyltransferase. |
| CCG46997.1 protein network | https://string-db.org/network/866895.HBHAL_4659 | Conserved hypothetical protein; May function as heme-dependent peroxidase. |
| cwlJ2 protein network | https://string-db.org/network/866895.HBHAL_4660 | Cell wall hydrolase CwlJ. |
| gerQ protein network | https://string-db.org/network/866895.HBHAL_4661 | Spore coat protein GerQ. |
| CCG47000.1 protein network | https://string-db.org/network/866895.HBHAL_4662 | Hypothetical protein. |
| CCG47001.1 protein network | https://string-db.org/network/866895.HBHAL_4663 | Hypothetical protein. |
| CCG47002.1 protein network | https://string-db.org/network/866895.HBHAL_4664 | Hypothetical protein. |
| CCG47003.1 protein network | https://string-db.org/network/866895.HBHAL_4665 | Sodium-dependent transporter. |
| CCG47004.1 protein network | https://string-db.org/network/866895.HBHAL_4666 | ABC-type transport system permease protein. |
| CCG47005.1 protein network | https://string-db.org/network/866895.HBHAL_4667 | Hypothetical protein. |
| aarF protein network | https://string-db.org/network/866895.HBHAL_4668 | ABC-1 domain protein. |
| CCG47007.1 protein network | https://string-db.org/network/866895.HBHAL_4669 | Acetyltransferase, GNAT family. |
| CCG47008.1 protein network | https://string-db.org/network/866895.HBHAL_4670 | Homolog to fructosamine kinase. |
| CCG47009.1 protein network | https://string-db.org/network/866895.HBHAL_4671 | Hypothetical protein. |
| CCG47010.1 protein network | https://string-db.org/network/866895.HBHAL_4672 | Hypothetical protein. |
| CCG47011.1 protein network | https://string-db.org/network/866895.HBHAL_4673 | ThiJ/PfpI domain protein. |
| ykrP protein network | https://string-db.org/network/866895.HBHAL_4674 | Hypothetical protein. |
| ampS1 protein network | https://string-db.org/network/866895.HBHAL_4675 | M29 family aminopeptidase. |
| CCG47014.1 protein network | https://string-db.org/network/866895.HBHAL_4676 | Conserved hypothetical protein. |
| phrB protein network | https://string-db.org/network/866895.HBHAL_4677 | Deoxyribodipyrimidine photo-lyase; Belongs to the DNA photolyase family. |
| ribH protein network | https://string-db.org/network/866895.HBHAL_4678 | Riboflavin synthase beta subunit; Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2- butanone 4-phosphate. This is [...] |
| ribA protein network | https://string-db.org/network/866895.HBHAL_4679 | Bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II protein; Catalyzes the conversion of D-ribulose 5-phosphate to formate and 3,4-dihydroxy-2-butanone 4-phosphate; [...] |
| ribE protein network | https://string-db.org/network/866895.HBHAL_4680 | Riboflavin synthase alpha subunit. |
| CCG47019.1 protein network | https://string-db.org/network/866895.HBHAL_4681 | Riboflavin biosynthesis protein RibD; Converts 2,5-diamino-6-(ribosylamino)-4(3h)-pyrimidinone 5'- phosphate into 5-amino-6-(ribosylamino)-2,4(1h,3h)-pyrimidinedione 5'- phosphate; In the C-termi [...] |
| CCG47020.1 protein network | https://string-db.org/network/866895.HBHAL_4682 | Hypothetical protein. |
| CCG47021.1 protein network | https://string-db.org/network/866895.HBHAL_4683 | Hypothetical protein. |
| CCG47022.1 protein network | https://string-db.org/network/866895.HBHAL_4684 | Hypothetical protein. |
| CCG47023.1 protein network | https://string-db.org/network/866895.HBHAL_4685 | Hypothetical protein. |
| CCG47024.1 protein network | https://string-db.org/network/866895.HBHAL_4686 | UvrD/REP helicase family protein. |
| CCG47025.1 protein network | https://string-db.org/network/866895.HBHAL_4687 | Conserved hypothetical protein. |
| HBHAL_4691 protein network | https://string-db.org/network/866895.HBHAL_4691 | Conserved hypothetical protein (nonfunctional). |
| CCG47030.1 protein network | https://string-db.org/network/866895.HBHAL_4692 | Conserved hypothetical protein. |
| CCG47031.1 protein network | https://string-db.org/network/866895.HBHAL_4693 | Conserved hypothetical protein. |
| CCG47032.1 protein network | https://string-db.org/network/866895.HBHAL_4694 | Conserved hypothetical protein. |
| CCG47033.1 protein network | https://string-db.org/network/866895.HBHAL_4695 | Conserved hypothetical protein. |
| CCG47034.1 protein network | https://string-db.org/network/866895.HBHAL_4696 | Conserved hypothetical protein. |
| CCG47035.1 protein network | https://string-db.org/network/866895.HBHAL_4697 | Conserved hypothetical protein. |
| CCG47036.1 protein network | https://string-db.org/network/866895.HBHAL_4698 | Conserved hypothetical protein. |
| CCG47037.1 protein network | https://string-db.org/network/866895.HBHAL_4699 | Conserved hypothetical protein. |
| CCG47038.1 protein network | https://string-db.org/network/866895.HBHAL_4700 | Conserved hypothetical protein. |
| CCG47039.1 protein network | https://string-db.org/network/866895.HBHAL_4701 | Conserved hypothetical protein. |
| CCG47040.1 protein network | https://string-db.org/network/866895.HBHAL_4702 | Conserved hypothetical protein. |
| CCG47041.1 protein network | https://string-db.org/network/866895.HBHAL_4703 | Conserved hypothetical protein. |
| CCG47042.1 protein network | https://string-db.org/network/866895.HBHAL_4704 | Conserved hypothetical protein. |
| CCG47043.1 protein network | https://string-db.org/network/866895.HBHAL_4705 | Conserved hypothetical protein. |
| CCG47044.1 protein network | https://string-db.org/network/866895.HBHAL_4706 | Conserved hypothetical protein. |
| CCG47045.1 protein network | https://string-db.org/network/866895.HBHAL_4707 | Conserved hypothetical protein. |
| CCG47046.1 protein network | https://string-db.org/network/866895.HBHAL_4708 | Conserved hypothetical protein. |
| CCG47047.1 protein network | https://string-db.org/network/866895.HBHAL_4709 | Conserved hypothetical protein. |
| CCG47048.1 protein network | https://string-db.org/network/866895.HBHAL_4710 | Conserved hypothetical protein. |
| CCG47049.1 protein network | https://string-db.org/network/866895.HBHAL_4711 | Conserved hypothetical protein. |
| CCG47050.1 protein network | https://string-db.org/network/866895.HBHAL_4712 | Conserved hypothetical protein. |
| CCG47051.1 protein network | https://string-db.org/network/866895.HBHAL_4713 | DnaD domain protein. |
| CCG47052.1 protein network | https://string-db.org/network/866895.HBHAL_4714 | HTH domain protein. |
| CCG47053.1 protein network | https://string-db.org/network/866895.HBHAL_4715 | Conserved hypothetical protein. |
| CCG47054.1 protein network | https://string-db.org/network/866895.HBHAL_4716 | HTH domain protein. |
| CCG47055.1 protein network | https://string-db.org/network/866895.HBHAL_4717 | SinR/xre family transcription regulator. |
| CCG47056.1 protein network | https://string-db.org/network/866895.HBHAL_4718 | Hypothetical protein. |
| CCG47057.1 protein network | https://string-db.org/network/866895.HBHAL_4719 | Hypothetical protein. |
| CCG47058.1 protein network | https://string-db.org/network/866895.HBHAL_4720 | Hypothetical protein. |
| CCG47059.1 protein network | https://string-db.org/network/866895.HBHAL_4721 | Conserved hypothetical protein. |
| CCG47060.1 protein network | https://string-db.org/network/866895.HBHAL_4722 | Hypothetical protein. |
| CCG47061.1 protein network | https://string-db.org/network/866895.HBHAL_4723 | PadR family transcription regulator. |
| CCG47062.1 protein network | https://string-db.org/network/866895.HBHAL_4724 | Hypothetical protein. |
| CCG47063.1 protein network | https://string-db.org/network/866895.HBHAL_4725 | Hypothetical protein. |
| CCG47066.1 protein network | https://string-db.org/network/866895.HBHAL_4728 | Conserved hypothetical protein. |
| CCG47067.1 protein network | https://string-db.org/network/866895.HBHAL_4729 | Phage integrase domain protein; Belongs to the 'phage' integrase family. |
| CCG47068.1 protein network | https://string-db.org/network/866895.HBHAL_4730 | Hypothetical protein. |
| HBHAL_4732 protein network | https://string-db.org/network/866895.HBHAL_4732 | Locus_tag: HBHAL_4731; product: AB hydrolase superfamily protein (nonfunctional); gene has been targetted by a transposon; conceptual translation after in silico reconstruction: MYYTSSGAGVPIVFIHP [...] |
| CCG47071.1 protein network | https://string-db.org/network/866895.HBHAL_4733 | Hypothetical protein. |
| CCG47072.1 protein network | https://string-db.org/network/866895.HBHAL_4734 | Hypothetical protein. |
| CCG47073.1 protein network | https://string-db.org/network/866895.HBHAL_4735 | Hypothetical protein. |
| CCG47074.1 protein network | https://string-db.org/network/866895.HBHAL_4736 | Conserved hypothetical protein. |
| CCG47075.1 protein network | https://string-db.org/network/866895.HBHAL_4737 | Hypothetical protein. |
| CCG47076.1 protein network | https://string-db.org/network/866895.HBHAL_4738 | Spore coat protein. |
| uvrX protein network | https://string-db.org/network/866895.HBHAL_4739 | Probable UV-damage repair protein uvrX; Belongs to the DNA polymerase type-Y family. |
| malL3 protein network | https://string-db.org/network/866895.HBHAL_4740 | Oligo-1,6-glucosidase. |
| ymaD protein network | https://string-db.org/network/866895.HBHAL_4741 | Hypothetical protein. |
| CCG47080.1 protein network | https://string-db.org/network/866895.HBHAL_4742 | Conserved hypothetical protein. |
| CCG47081.1 protein network | https://string-db.org/network/866895.HBHAL_4743 | Acetyltransferase, GNAT family. |
| CCG47082.1 protein network | https://string-db.org/network/866895.HBHAL_4744 | Conserved hypothetical protein. |
| CCG47083.1 protein network | https://string-db.org/network/866895.HBHAL_4745 | Hypothetical protein. |
| ykoY3 protein network | https://string-db.org/network/866895.HBHAL_4746 | TerC family protein. |
| CCG47085.1 protein network | https://string-db.org/network/866895.HBHAL_4747 | Hypothetical protein. |
| pepT protein network | https://string-db.org/network/866895.HBHAL_4748 | Peptidase T; Cleaves the N-terminal amino acid of tripeptides. Belongs to the peptidase M20B family. |
| CCG47087.1 protein network | https://string-db.org/network/866895.HBHAL_4749 | UPF0118 family protein. |
| CCG47088.1 protein network | https://string-db.org/network/866895.HBHAL_4750 | MFS-type transporter. |
| dctP2 protein network | https://string-db.org/network/866895.HBHAL_4751 | TRAP-T type transporter subunit DctP. |
| dctM2 protein network | https://string-db.org/network/866895.HBHAL_4752 | TRAP-T type transporter subunit DctM. |
| dctQ2 protein network | https://string-db.org/network/866895.HBHAL_4753 | TRAP-T type transporter subunit DctQ. |
| CCG47092.1 protein network | https://string-db.org/network/866895.HBHAL_4754 | Acetyltransferase, GNAT family. |
| CCG47093.1 protein network | https://string-db.org/network/866895.HBHAL_4755 | Hypothetical protein. |
| CCG47094.1 protein network | https://string-db.org/network/866895.HBHAL_4756 | Na+/H+ antiporter family protein. |
| CCG47095.1 protein network | https://string-db.org/network/866895.HBHAL_4757 | Branched-chain amino acid transport system II carrier family protein; Component of the transport system for branched-chain amino acids. |
| CCG47096.1 protein network | https://string-db.org/network/866895.HBHAL_4758 | Hypothetical protein. |
| CCG47097.1 protein network | https://string-db.org/network/866895.HBHAL_4759 | Conserved hypothetical protein. |
| CCG47098.1 protein network | https://string-db.org/network/866895.HBHAL_4760 | Conserved hypothetical protein. |
| CCG47099.1 protein network | https://string-db.org/network/866895.HBHAL_4761 | Oxidoreductase, zinc-binding. |
| recQ protein network | https://string-db.org/network/866895.HBHAL_4762 | ATP-dependent DNA helicase RecQ. |
| kynU protein network | https://string-db.org/network/866895.HBHAL_4763 | Kynureninase; Catalyzes the cleavage of L-kynurenine (L-Kyn) and L-3- hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3- hydroxyanthranilic acid (3-OHAA), respectively. |
| kynB protein network | https://string-db.org/network/866895.HBHAL_4764 | Kynurenine formamidase; Catalyzes the hydrolysis of N-formyl-L-kynurenine to L- kynurenine, the second step in the kynurenine pathway of tryptophan degradation. |
| CCG47103.1 protein network | https://string-db.org/network/866895.HBHAL_4765 | BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family. |
| CCG47104.1 protein network | https://string-db.org/network/866895.HBHAL_4766 | Hypothetical protein. |
| crtD protein network | https://string-db.org/network/866895.HBHAL_4767 | Amine oxidase. |
| ampS2 protein network | https://string-db.org/network/866895.HBHAL_4768 | M29 family aminopeptidase. |
| CCG47107.1 protein network | https://string-db.org/network/866895.HBHAL_4769 | ABC-type transport system ATP-binding protein. |
| CCG47108.1 protein network | https://string-db.org/network/866895.HBHAL_4770 | Alanine or glycine/cation symporter, AGCS family. |
| CCG47109.1 protein network | https://string-db.org/network/866895.HBHAL_4771 | ABC-type transport system extracellular binding protein (probable substrate iron(III)). |
| CCG47110.1 protein network | https://string-db.org/network/866895.HBHAL_4772 | ABC-type transport system permease protein (probable substrate iron(III)). |
| CCG47111.1 protein network | https://string-db.org/network/866895.HBHAL_4773 | ABC-type transport system ATP-binding protein (probable substrate iron(III)). |
| CCG47112.1 protein network | https://string-db.org/network/866895.HBHAL_4774 | acyl-CoA thioester hydrolase. |
| CCG47113.1 protein network | https://string-db.org/network/866895.HBHAL_4775 | Two-component sensor histidine kinase. |
| CCG47114.1 protein network | https://string-db.org/network/866895.HBHAL_4776 | Two-component response regulator. |
| CCG47115.1 protein network | https://string-db.org/network/866895.HBHAL_4777 | Serine protease. |
| CCG47116.1 protein network | https://string-db.org/network/866895.HBHAL_4778 | MerR family transcription regulator. |
| CCG47117.1 protein network | https://string-db.org/network/866895.HBHAL_4779 | Hypothetical protein. |
| cls2 protein network | https://string-db.org/network/866895.HBHAL_4780 | Cardiolipin synthetase; Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol. |
| CCG47119.1 protein network | https://string-db.org/network/866895.HBHAL_4781 | Conserved hypothetical protein. |
| CCG47120.1 protein network | https://string-db.org/network/866895.HBHAL_4782 | Sucrose-6-phosphate hydrolase; Enables the bacterium to metabolize sucrose as a sole carbon source; Belongs to the glycosyl hydrolase 32 family. |
| CCG47121.1 protein network | https://string-db.org/network/866895.HBHAL_4783 | Fructokinase; Belongs to the carbohydrate kinase PfkB family. |
| CCG47122.1 protein network | https://string-db.org/network/866895.HBHAL_4784 | PTS system subunit IIA, glucose-specific. |
| CCG47123.1 protein network | https://string-db.org/network/866895.HBHAL_4785 | Methionine gamma-lyase. |
| CCG47125.1 protein network | https://string-db.org/network/866895.HBHAL_4787 | Diguanylate phosphodiesterase domain protein. |
| CCG47126.1 protein network | https://string-db.org/network/866895.HBHAL_4788 | FAD-dependent oxidoreductase / Rieske-type iron-sulfur protein. |
| rarD protein network | https://string-db.org/network/866895.HBHAL_4789 | RarD protein. |
| CCG47128.1 protein network | https://string-db.org/network/866895.HBHAL_4790 | IS1341-type transposase. |
| CCG47129.1 protein network | https://string-db.org/network/866895.HBHAL_4791 | Conserved hypothetical protein. |
| CCG47130.1 protein network | https://string-db.org/network/866895.HBHAL_4792 | Hypothetical protein. |
| CCG47131.1 protein network | https://string-db.org/network/866895.HBHAL_4793 | TetR family transcription regulator. |
| CCG47132.1 protein network | https://string-db.org/network/866895.HBHAL_4794 | Hypothetical protein. |
| CCG47133.1 protein network | https://string-db.org/network/866895.HBHAL_4795 | FAD-dependent oxidoreductase. |
| CCG47134.1 protein network | https://string-db.org/network/866895.HBHAL_4796 | Aldo/keto reductase family protein. |
| CCG47135.1 protein network | https://string-db.org/network/866895.HBHAL_4797 | Hypothetical protein. |
| CCG47136.1 protein network | https://string-db.org/network/866895.HBHAL_4798 | ABC-type transport system ATP-binding protein. |
| CCG47137.1 protein network | https://string-db.org/network/866895.HBHAL_4799 | Hypothetical protein. |
| CCG47139.1 protein network | https://string-db.org/network/866895.HBHAL_4801 | O-acetylhomoserine sulfhydrylase. |
| metX protein network | https://string-db.org/network/866895.HBHAL_4802 | Homoserine O-acetyltransferase; Transfers an acetyl group from acetyl-CoA to L-homoserine, forming acetyl-L-homoserine. |
| CCG47141.1 protein network | https://string-db.org/network/866895.HBHAL_4803 | Putative carbohydrate esterase family 4 protein. |
| kynA protein network | https://string-db.org/network/866895.HBHAL_4804 | Tryptophan 2,3-dioxygenase; Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring and converts L- tryptophan to N-formyl-L-kynurenine. Catalyze [...] |
| yndH protein network | https://string-db.org/network/866895.HBHAL_4805 | Hypothetical protein. |
| CCG47144.1 protein network | https://string-db.org/network/866895.HBHAL_4806 | Hypothetical protein. |
| rpiA protein network | https://string-db.org/network/866895.HBHAL_4807 | Putative ribose 5-phosphate isomerase. |
| CCG47146.1 protein network | https://string-db.org/network/866895.HBHAL_4808 | Hypothetical protein. |
| CCG47147.1 protein network | https://string-db.org/network/866895.HBHAL_4809 | Two-component response regulator. |
| CCG47148.1 protein network | https://string-db.org/network/866895.HBHAL_4810 | Two-component sensor histidine kinase. |
| CCG47149.1 protein network | https://string-db.org/network/866895.HBHAL_4811 | Conserved hypothetical protein. |
| CCG47150.1 protein network | https://string-db.org/network/866895.HBHAL_4812 | Hypothetical protein. |
| CCG47151.1 protein network | https://string-db.org/network/866895.HBHAL_4813 | Hypothetical protein. |
| CCG47152.1 protein network | https://string-db.org/network/866895.HBHAL_4814 | M24 family peptidase; Belongs to the peptidase M24B family. |
| CCG47153.1 protein network | https://string-db.org/network/866895.HBHAL_4815 | Hypothetical protein. |
| CCG47154.1 protein network | https://string-db.org/network/866895.HBHAL_4816 | Glucose sorbosone dehydrogenase. |
| bioY1 protein network | https://string-db.org/network/866895.HBHAL_4817 | BioY family protein. |
| CCG47156.1 protein network | https://string-db.org/network/866895.HBHAL_4818 | Hypothetical protein. |
| CCG47157.1 protein network | https://string-db.org/network/866895.HBHAL_4819 | Hypothetical protein. |
| ypmR protein network | https://string-db.org/network/866895.HBHAL_4820 | Conserved hypothetical protein. |
| ypmS protein network | https://string-db.org/network/866895.HBHAL_4821 | Conserved hypothetical protein. |
| cysK2 protein network | https://string-db.org/network/866895.HBHAL_4822 | Cysteine synthase; Belongs to the cysteine synthase/cystathionine beta- synthase family. |
| yvgT protein network | https://string-db.org/network/866895.HBHAL_4823 | Hypothetical protein. |
| CCG47162.1 protein network | https://string-db.org/network/866895.HBHAL_4824 | Two-component hybrid sensor and regulator. |
| CCG47163.1 protein network | https://string-db.org/network/866895.HBHAL_4825 | Hypothetical protein. |
| yqjF protein network | https://string-db.org/network/866895.HBHAL_4826 | Conserved hypothetical protein. |
| ykcA protein network | https://string-db.org/network/866895.HBHAL_4827 | Glyoxalase domain protein. |
| CCG47166.1 protein network | https://string-db.org/network/866895.HBHAL_4828 | Aconitate hydratase. |
| npr4 protein network | https://string-db.org/network/866895.HBHAL_4829 | Neutral protease; Extracellular zinc metalloprotease. |
| CCG47168.1 protein network | https://string-db.org/network/866895.HBHAL_4830 | NprR family transcription regulator. |
| CCG47169.1 protein network | https://string-db.org/network/866895.HBHAL_4831 | Hypothetical protein. |
| CCG47170.1 protein network | https://string-db.org/network/866895.HBHAL_4832 | Hypothetical protein. |
| CCG47171.1 protein network | https://string-db.org/network/866895.HBHAL_4833 | Hypothetical protein. |
| treR protein network | https://string-db.org/network/866895.HBHAL_4834 | GntR family trehalose operon transcription repressor. |
| treA protein network | https://string-db.org/network/866895.HBHAL_4835 | Trehalose-6-phosphate hydrolase. |
| CCG47174.1 protein network | https://string-db.org/network/866895.HBHAL_4836 | PTS system subunit IIBC, trehalose-specific. |
| CCG47175.1 protein network | https://string-db.org/network/866895.HBHAL_4837 | PTS system subunit IIA, trehalose-specific. |
| CCG47176.1 protein network | https://string-db.org/network/866895.HBHAL_4838 | Conserved hypothetical protein. |
| yueJ protein network | https://string-db.org/network/866895.HBHAL_4839 | Pyrazinamidase / nicotinamidase. |
| CCG47178.1 protein network | https://string-db.org/network/866895.HBHAL_4840 | MFS-type transporter (probable metal-tetracycline-proton antiporter). |
| ybfQ protein network | https://string-db.org/network/866895.HBHAL_4841 | UPF0176 family protein; Belongs to the UPF0176 family. |
| CCG47180.1 protein network | https://string-db.org/network/866895.HBHAL_4842 | Hypothetical protein. |
| CCG47181.1 protein network | https://string-db.org/network/866895.HBHAL_4843 | Hypothetical protein; Belongs to the peptidase S51 family. |
| CCG47182.1 protein network | https://string-db.org/network/866895.HBHAL_4844 | Phosphomethylpyrimidine kinase. |
| CCG47183.1 protein network | https://string-db.org/network/866895.HBHAL_4844_A | Conserved hypothetical protein. |
| CCG47184.1 protein network | https://string-db.org/network/866895.HBHAL_4845 | Conserved hypothetical protein. |
| yhfK2 protein network | https://string-db.org/network/866895.HBHAL_4846 | Conserved hypothetical protein. |
| CCG47186.1 protein network | https://string-db.org/network/866895.HBHAL_4847 | NprR family transcription regulator. |
| ypcP protein network | https://string-db.org/network/866895.HBHAL_4848 | 5'-3' exonuclease family protein. |
| CCG47188.1 protein network | https://string-db.org/network/866895.HBHAL_4849 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| CCG47189.1 protein network | https://string-db.org/network/866895.HBHAL_4850 | Conserved hypothetical protein. |
| CCG47190.1 protein network | https://string-db.org/network/866895.HBHAL_4851 | AB hydrolase superfamily protein. |
| CCG47191.1 protein network | https://string-db.org/network/866895.HBHAL_4852 | Acetyltransferase, GNAT family. |
| CCG47192.1 protein network | https://string-db.org/network/866895.HBHAL_4853 | Putative oxidoreductase. |
| bioY2 protein network | https://string-db.org/network/866895.HBHAL_4854 | BioY family protein. |
| CCG47194.1 protein network | https://string-db.org/network/866895.HBHAL_4856 | Hypothetical protein. |
| CCG47195.1 protein network | https://string-db.org/network/866895.HBHAL_4857 | Hypothetical protein. |
| CCG47196.1 protein network | https://string-db.org/network/866895.HBHAL_4858 | Hypothetical protein. |
| CCG47197.1 protein network | https://string-db.org/network/866895.HBHAL_4859 | Hypothetical protein. |
| pabB protein network | https://string-db.org/network/866895.HBHAL_4860 | Para-aminobenzoate synthase subunit I. |
| trpG2 protein network | https://string-db.org/network/866895.HBHAL_4861 | Anthranilate synthase component II. |
| CCG47200.1 protein network | https://string-db.org/network/866895.HBHAL_4862 | Two-component sensor histidine kinase. |
| CCG47201.1 protein network | https://string-db.org/network/866895.HBHAL_4863 | Two-component response regulator. |
| CCG47202.1 protein network | https://string-db.org/network/866895.HBHAL_4864 | Hypothetical protein. |
| CCG47203.1 protein network | https://string-db.org/network/866895.HBHAL_4865 | Conserved hypothetical protein. |
| CCG47204.1 protein network | https://string-db.org/network/866895.HBHAL_4866 | MFS-type transporter. |
| CCG47205.1 protein network | https://string-db.org/network/866895.HBHAL_4867 | Hypothetical protein. |
| ykjE protein network | https://string-db.org/network/866895.HBHAL_4868 | NUDIX family hydrolase; Belongs to the Nudix hydrolase family. |
| ybbD protein network | https://string-db.org/network/866895.HBHAL_4869 | Family 3 glycoside hydrolase. |
| CCG47208.1 protein network | https://string-db.org/network/866895.HBHAL_4870 | Amidase; Belongs to the amidase family. |
| CCG47209.1 protein network | https://string-db.org/network/866895.HBHAL_4871 | Hypothetical protein. |
| CCG47210.1 protein network | https://string-db.org/network/866895.HBHAL_4873 | Conserved hypothetical protein. |
| yfmL protein network | https://string-db.org/network/866895.HBHAL_4874 | Probable ATP-dependent RNA helicase YfmL. |
| CCG47212.1 protein network | https://string-db.org/network/866895.HBHAL_4875 | Conserved hypothetical protein. |
| CCG47213.1 protein network | https://string-db.org/network/866895.HBHAL_4876 | Conserved hypothetical protein. |
| CCG47214.1 protein network | https://string-db.org/network/866895.HBHAL_4877 | Hypothetical protein. |
| CCG47215.1 protein network | https://string-db.org/network/866895.HBHAL_4878 | RDD domain protein. |
| CCG47216.1 protein network | https://string-db.org/network/866895.HBHAL_4879 | Pyridoxal-dependent decarboxylase; Belongs to the Orn/Lys/Arg decarboxylase class-II family. |
| CCG47217.1 protein network | https://string-db.org/network/866895.HBHAL_4880 | Hypothetical protein. |
| figA protein network | https://string-db.org/network/866895.HBHAL_4881 | Hypothetical protein. |
| CCG47219.1 protein network | https://string-db.org/network/866895.HBHAL_4882 | Hypothetical protein. |
| CCG47221.1 protein network | https://string-db.org/network/866895.HBHAL_4884 | Hypothetical protein. |
| argF protein network | https://string-db.org/network/866895.HBHAL_4885 | Ornithine carbamoyltransferase; Reversibly catalyzes the transfer of the carbamoyl group from carbamoyl phosphate (CP) to the N(epsilon) atom of ornithine (ORN) to produce L-citrulline. |
| carB2 protein network | https://string-db.org/network/866895.HBHAL_4886 | Carbamoyl phosphate synthase large subunit; Belongs to the CarB family. |
| carA2 protein network | https://string-db.org/network/866895.HBHAL_4887 | Carbamoyl phosphate synthase small subunit; Belongs to the CarA family. |
| argD protein network | https://string-db.org/network/866895.HBHAL_4888 | Acetylornithine aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily. |
| argB protein network | https://string-db.org/network/866895.HBHAL_4889 | Acetylglutamate kinase; Catalyzes the ATP-dependent phosphorylation of N-acetyl-L- glutamate; Belongs to the acetylglutamate kinase family. ArgB subfamily. |
| argJ protein network | https://string-db.org/network/866895.HBHAL_4890 | Glutamate N-acetyltransferase; Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the [...] |
| argC protein network | https://string-db.org/network/866895.HBHAL_4891 | N-acetyl-gamma-glutamyl-phosphate reductase; Catalyzes the NADPH-dependent reduction of N-acetyl-5- glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. Belongs to the NAGSA dehydroge [...] |
| CCG47229.1 protein network | https://string-db.org/network/866895.HBHAL_4892 | NAD-dependent epimerase/dehydratase. |
| CCG47231.1 protein network | https://string-db.org/network/866895.HBHAL_4894 | Putative L-lysine 6-monooxygenase. |
| CCG47232.1 protein network | https://string-db.org/network/866895.HBHAL_4895 | Acetyltransferase, GNAT family. |
| CCG47233.1 protein network | https://string-db.org/network/866895.HBHAL_4896 | Spore germination protein KA. |
| CCG47234.1 protein network | https://string-db.org/network/866895.HBHAL_4897 | Spore germination protein KC. |
| CCG47235.1 protein network | https://string-db.org/network/866895.HBHAL_4898 | Hypothetical protein. |
| CCG47236.1 protein network | https://string-db.org/network/866895.HBHAL_4899 | Spore germination protein. |
| CCG47237.1 protein network | https://string-db.org/network/866895.HBHAL_4900 | Hypothetical protein. |
| CCG47238.1 protein network | https://string-db.org/network/866895.HBHAL_4901 | Hypothetical protein. |
| rluD4 protein network | https://string-db.org/network/866895.HBHAL_4902 | Pseudouridine synthase; Responsible for synthesis of pseudouridine from uracil. Belongs to the pseudouridine synthase RluA family. |
| CCG47240.1 protein network | https://string-db.org/network/866895.HBHAL_4903 | Phosphoesterase, PA-phosphatase related. |
| CCG47241.1 protein network | https://string-db.org/network/866895.HBHAL_4904 | ABC-type transport system ATP-binding/permease protein. |
| CCG47242.1 protein network | https://string-db.org/network/866895.HBHAL_4905 | ABC-type transport system ATP-binding/permease protein. |
| CCG47243.1 protein network | https://string-db.org/network/866895.HBHAL_4906 | Hypothetical protein. |
| CCG47244.1 protein network | https://string-db.org/network/866895.HBHAL_4907 | Hypothetical protein. |
| CCG47245.1 protein network | https://string-db.org/network/866895.HBHAL_4908 | Oxidoreductase. |
| CCG47246.1 protein network | https://string-db.org/network/866895.HBHAL_4909 | Putative oxidoreductase. |
| CCG47247.1 protein network | https://string-db.org/network/866895.HBHAL_4910 | Hypothetical protein. |
| CCG47248.1 protein network | https://string-db.org/network/866895.HBHAL_4911 | Conserved hypothetical protein. |
| CCG47249.1 protein network | https://string-db.org/network/866895.HBHAL_4912 | Aldehyde dehydrogenase. |
| hom2 protein network | https://string-db.org/network/866895.HBHAL_4913 | Homoserine dehydrogenase. |
| CCG47251.1 protein network | https://string-db.org/network/866895.HBHAL_4914 | Aminoacylase. |
| metB2 protein network | https://string-db.org/network/866895.HBHAL_4915 | Cystathionine gamma-synthase. |
| arcB protein network | https://string-db.org/network/866895.HBHAL_4916 | Ornithine cyclodeaminase. |
| CCG47254.1 protein network | https://string-db.org/network/866895.HBHAL_4917 | M24 family peptidase. |
| thrC3 protein network | https://string-db.org/network/866895.HBHAL_4918 | Threonine synthase. |
| CCG47257.1 protein network | https://string-db.org/network/866895.HBHAL_4920 | BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family. |
| CCG47258.1 protein network | https://string-db.org/network/866895.HBHAL_4921 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| thiE protein network | https://string-db.org/network/866895.HBHAL_4922 | Thiamine-phosphate synthase; Condenses 4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate (THZ-P) and 2-methyl-4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-PP) to form thiamine monopho [...] |
| thiM protein network | https://string-db.org/network/866895.HBHAL_4923 | Hydroxyethylthiazole kinase; Catalyzes the phosphorylation of the hydroxyl group of 4- methyl-5-beta-hydroxyethylthiazole (THZ); Belongs to the Thz kinase family. |
| thiD protein network | https://string-db.org/network/866895.HBHAL_4924 | Phosphomethylpyrimidine kinase. |
| tenA protein network | https://string-db.org/network/866895.HBHAL_4925 | Thiaminase; Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway; Belongs to the TenA [...] |
| thiW protein network | https://string-db.org/network/866895.HBHAL_4926 | ThiW family protein. |
| CCG47264.1 protein network | https://string-db.org/network/866895.HBHAL_4927 | Hypothetical protein. |
| CCG47265.1 protein network | https://string-db.org/network/866895.HBHAL_4928 | PucR family transcription regulator. |
| CCG47266.1 protein network | https://string-db.org/network/866895.HBHAL_4929 | Threonine ammonia-lyase. |
| asnB protein network | https://string-db.org/network/866895.HBHAL_4930 | Asparagine synthase. |
| fic protein network | https://string-db.org/network/866895.HBHAL_4931 | Fic family protein. |
| CCG47269.1 protein network | https://string-db.org/network/866895.HBHAL_4932 | Hypothetical protein. |
| ykoV protein network | https://string-db.org/network/866895.HBHAL_4933 | Probable DNA repair protein YkoV; With LigD forms a non-homologous end joining (NHEJ) DNA repair enzyme, which repairs dsDNA breaks with reduced fidelity. Binds linear dsDNA with 5'- and 3'- over [...] |
| ligD protein network | https://string-db.org/network/866895.HBHAL_4934 | ATP-dependent DNA ligase. |
| CCG47272.1 protein network | https://string-db.org/network/866895.HBHAL_4935 | long-chain-fatty-acid--CoA ligase. |
| CCG47273.1 protein network | https://string-db.org/network/866895.HBHAL_4936 | Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| CCG47274.1 protein network | https://string-db.org/network/866895.HBHAL_4937 | acetyl-CoA acetyltransferase; Belongs to the thiolase-like superfamily. Thiolase family. |
| CCG47275.1 protein network | https://string-db.org/network/866895.HBHAL_4938 | acyl-CoA dehydrogenase. |
| ycsE protein network | https://string-db.org/network/866895.HBHAL_4940 | HAD superfamily hydrolase. |
| metQ3 protein network | https://string-db.org/network/866895.HBHAL_4941 | ABC-type transport system extracellular binding protein (probable substrate methionine); Belongs to the nlpA lipoprotein family. |
| metP3 protein network | https://string-db.org/network/866895.HBHAL_4942 | ABC-type transport system permease protein (probable substrate methionine). |
| metN3 protein network | https://string-db.org/network/866895.HBHAL_4943 | ABC-type transport system ATP-binding protein (probable substrate methionine); Part of the ABC transporter complex MetNIQ involved in methionine import. Responsible for energy coupling to the tra [...] |
| CCG47280.1 protein network | https://string-db.org/network/866895.HBHAL_4944 | Conserved hypothetical protein. |
| CCG47281.1 protein network | https://string-db.org/network/866895.HBHAL_4945 | Hypothetical protein. |
| CCG47282.1 protein network | https://string-db.org/network/866895.HBHAL_4946 | Hypothetical protein. |
| yrkE protein network | https://string-db.org/network/866895.HBHAL_4947 | Conserved hypothetical protein. |
| CCG47284.1 protein network | https://string-db.org/network/866895.HBHAL_4948 | Rhodanese domain protein. |
| yrkF protein network | https://string-db.org/network/866895.HBHAL_4949 | tusA/rhodanese domain protein; Belongs to the sulfur carrier protein TusA family. |
| CCG47286.1 protein network | https://string-db.org/network/866895.HBHAL_4950 | Metallo-beta-lactamase family protein. |
| yrkI protein network | https://string-db.org/network/866895.HBHAL_4951 | UPF0033 family protein; Belongs to the sulfur carrier protein TusA family. |
| yrkJ protein network | https://string-db.org/network/866895.HBHAL_4952 | UPF0721 family protein. |
| yqgS4 protein network | https://string-db.org/network/866895.HBHAL_4953 | yqgS family protein; Belongs to the LTA synthase family. |
| yjoA protein network | https://string-db.org/network/866895.HBHAL_4954 | Hypothetical protein. |
| CCG47291.1 protein network | https://string-db.org/network/866895.HBHAL_4955 | Conserved hypothetical protein. |
| CCG47292.1 protein network | https://string-db.org/network/866895.HBHAL_4956 | Homolog to PGA biosynthesis protein CapA. |
| cbaA protein network | https://string-db.org/network/866895.HBHAL_4958 | Cytochrome c oxidase subunit I; Belongs to the heme-copper respiratory oxidase family. |
| cbaB protein network | https://string-db.org/network/866895.HBHAL_4959 | Cytochrome c oxidase subunit II. |
| cbaD protein network | https://string-db.org/network/866895.HBHAL_4959_A | Cytochrome c oxidase subunit IIa. |
| CCG47297.1 protein network | https://string-db.org/network/866895.HBHAL_4960 | Two-component sensor histidine kinase. |
| nreA protein network | https://string-db.org/network/866895.HBHAL_4961 | Hypothetical protein. |
| CCG47299.1 protein network | https://string-db.org/network/866895.HBHAL_4962 | Two-component response regulator. |
| CCG47300.1 protein network | https://string-db.org/network/866895.HBHAL_4963 | Homolog to histidine kinase dimerisation domain. |
| CCG47301.1 protein network | https://string-db.org/network/866895.HBHAL_4964 | Hypothetical protein. |
| CCG47302.1 protein network | https://string-db.org/network/866895.HBHAL_4965 | Hypothetical protein. |
| HBHAL_4968 protein network | https://string-db.org/network/866895.HBHAL_4968 | Locus_tag: HBHAL_4967; product: ABC-type transport system ATP-binding protein (nonfunctional); gene has an in-frame stop codon; conceptual translation after in silico reconstruction: MERNLVVEDCKV [...] |
| CCG47306.1 protein network | https://string-db.org/network/866895.HBHAL_4969 | Hypothetical protein. |
| isp protein network | https://string-db.org/network/866895.HBHAL_4970 | Intracellular serine protease; Belongs to the peptidase S8 family. |
| CCG47308.1 protein network | https://string-db.org/network/866895.HBHAL_4971 | M23/M37 family peptidase. |
| ftsX protein network | https://string-db.org/network/866895.HBHAL_4972 | Cell-division protein; Part of the ABC transporter FtsEX involved in asymmetric cellular division facilitating the initiation of sporulation. Belongs to the ABC-4 integral membrane protein family [...] |
| CCG47310.1 protein network | https://string-db.org/network/866895.HBHAL_4973 | Hypothetical protein. |
| CCG47311.1 protein network | https://string-db.org/network/866895.HBHAL_4974 | Hypothetical protein. |
| racX protein network | https://string-db.org/network/866895.HBHAL_4975 | Aspartate racemase. |
| CCG47313.1 protein network | https://string-db.org/network/866895.HBHAL_4976 | UDP-N-acetylmuramyl-tripeptide synthetase; Belongs to the MurCDEF family. MurE subfamily. |
| CCG47314.1 protein network | https://string-db.org/network/866895.HBHAL_4977 | ATP-grasp domain protein. |
| CCG47315.1 protein network | https://string-db.org/network/866895.HBHAL_4978 | Hypothetical protein. |
| yqkA protein network | https://string-db.org/network/866895.HBHAL_4979 | Hypothetical protein. |
| CCG47317.1 protein network | https://string-db.org/network/866895.HBHAL_4980 | Peptidase. |
| katE protein network | https://string-db.org/network/866895.HBHAL_4981 | Catalase; Serves to protect cells from the toxic effects of hydrogen peroxide. |
| gltB1 protein network | https://string-db.org/network/866895.HBHAL_4982 | Glutamate synthase small subunit. |
| gltA protein network | https://string-db.org/network/866895.HBHAL_4983 | Glutamate synthase large subunit. |
| CCG47321.1 protein network | https://string-db.org/network/866895.HBHAL_4984 | S58/DmpA family peptidase. |
| yihY2 protein network | https://string-db.org/network/866895.HBHAL_4985 | YihY family protein; Belongs to the UPF0761 family. |
| sigL protein network | https://string-db.org/network/866895.HBHAL_4986 | RNA polymerase sigma factor SigL. |
| CCG47324.1 protein network | https://string-db.org/network/866895.HBHAL_4987 | Hypothetical protein. |
| CCG47325.1 protein network | https://string-db.org/network/866895.HBHAL_4988 | Pullulanase; Belongs to the glycosyl hydrolase 13 family. |
| glgP protein network | https://string-db.org/network/866895.HBHAL_4989 | Glycogen phosphorylase; Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural subst [...] |
| glgA protein network | https://string-db.org/network/866895.HBHAL_4990 | Glycogen synthase; Synthesizes alpha-1,4-glucan chains using ADP-glucose. |
| glgD protein network | https://string-db.org/network/866895.HBHAL_4991 | Glucose-1-phosphate adenylyltransferase subunit GlgD. |
| glgC protein network | https://string-db.org/network/866895.HBHAL_4992 | Glucose-1-phosphate adenylyltransferase; Involved in the biosynthesis of ADP-glucose, a building block required for the elongation reactions to produce glycogen. Catalyzes the reaction between AT [...] |
| glgB protein network | https://string-db.org/network/866895.HBHAL_4993 | Glycogen branching enzyme; Catalyzes the formation of the alpha-1,6-glucosidic linkages in glycogen by scission of a 1,4-alpha-linked oligosaccharide from growing alpha-1,4-glucan chains and the [...] |
| ytxG2 protein network | https://string-db.org/network/866895.HBHAL_4994 | UPF0478 family protein. |
| ytxG3 protein network | https://string-db.org/network/866895.HBHAL_4995 | UPF0478 family protein. |
| CCG47333.1 protein network | https://string-db.org/network/866895.HBHAL_4996 | Hypothetical protein. |
| CCG47334.1 protein network | https://string-db.org/network/866895.HBHAL_4997 | Hypothetical protein. |
| CCG47335.1 protein network | https://string-db.org/network/866895.HBHAL_4998 | Hypothetical protein. |
| CCG47336.1 protein network | https://string-db.org/network/866895.HBHAL_4999 | Sodium/dicarboxylate symporter family protein; Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. |
| CCG47337.1 protein network | https://string-db.org/network/866895.HBHAL_5000 | IS150-type transposase orfAB. |
| CCG47338.1 protein network | https://string-db.org/network/866895.HBHAL_5002 | Isopentenyl-diphosphate delta-isomerase II 2. |
| CCG47339.1 protein network | https://string-db.org/network/866895.HBHAL_5003 | IS110-type transposase. |
| CCG47340.1 protein network | https://string-db.org/network/866895.HBHAL_5004 | MFS-type transporter. |
| uspA6 protein network | https://string-db.org/network/866895.HBHAL_5005 | UspA domain protein. |
| CCG47342.1 protein network | https://string-db.org/network/866895.HBHAL_5006 | FAD-dependent pyridine nucleotide-disulfide oxidoreductase. |
| CCG47343.1 protein network | https://string-db.org/network/866895.HBHAL_5007 | Hypothetical protein. |
| CCG47344.1 protein network | https://string-db.org/network/866895.HBHAL_5008 | Conserved hypothetical protein. |
| CCG47345.1 protein network | https://string-db.org/network/866895.HBHAL_5009 | Hypothetical protein. |
| CCG47346.1 protein network | https://string-db.org/network/866895.HBHAL_5010 | PadR family transcription regulator. |
| CCG47347.1 protein network | https://string-db.org/network/866895.HBHAL_5011 | Conserved hypothetical protein. |
| des protein network | https://string-db.org/network/866895.HBHAL_5012 | Delta5 acyl-lipid desaturase. |
| CCG47349.1 protein network | https://string-db.org/network/866895.HBHAL_5013 | Two-component sensor histidine kinase. |
| CCG47350.1 protein network | https://string-db.org/network/866895.HBHAL_5014 | Two-component response regulator. |
| CCG47351.1 protein network | https://string-db.org/network/866895.HBHAL_5016 | Conserved hypothetical protein. |
| dapA3 protein network | https://string-db.org/network/866895.HBHAL_5017 | Dihydrodipicolinate synthase; Catalyzes the condensation of (S)-aspartate-beta-semialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA). |
| CCG47353.1 protein network | https://string-db.org/network/866895.HBHAL_5018 | Hypothetical protein. |
| CCG47354.1 protein network | https://string-db.org/network/866895.HBHAL_5019 | Peptidoglycan-binding LysM. |
| CCG47355.1 protein network | https://string-db.org/network/866895.HBHAL_5020 | Branched-chain amino acid aminotransferase. |
| CCG47356.1 protein network | https://string-db.org/network/866895.HBHAL_5021 | Two-component response regulator. |
| CCG47357.1 protein network | https://string-db.org/network/866895.HBHAL_5022 | Two-component sensor histidine kinase. |
| CCG47358.1 protein network | https://string-db.org/network/866895.HBHAL_5023 | ABC-type transport system ATP-binding protein. |
| CCG47359.1 protein network | https://string-db.org/network/866895.HBHAL_5024 | ABC-type transport system permease protein. |
| ymdB protein network | https://string-db.org/network/866895.HBHAL_5025 | O-acetyl-ADP-ribose deacetylase. |
| CCG47361.1 protein network | https://string-db.org/network/866895.HBHAL_5026 | NUDIX family hydrolase. |
| CCG47362.1 protein network | https://string-db.org/network/866895.HBHAL_5027 | Hypothetical protein. |
| CCG47363.1 protein network | https://string-db.org/network/866895.HBHAL_5028 | Hypothetical protein. |
| yhjR protein network | https://string-db.org/network/866895.HBHAL_5029 | Conserved hypothetical protein. |
| CCG47365.1 protein network | https://string-db.org/network/866895.HBHAL_5030 | Conserved hypothetical protein. |
| CCG47366.1 protein network | https://string-db.org/network/866895.HBHAL_5031 | Hypothetical protein. |
| CCG47367.1 protein network | https://string-db.org/network/866895.HBHAL_5032 | Hypothetical protein. |
| CCG47368.1 protein network | https://string-db.org/network/866895.HBHAL_5033 | Conserved hypothetical protein. |
| lytE2 protein network | https://string-db.org/network/866895.HBHAL_5034 | Homolog to cell wall hydrolase LytE. |
| CCG47370.1 protein network | https://string-db.org/network/866895.HBHAL_5035 | Hypothetical protein. |
| CCG47371.1 protein network | https://string-db.org/network/866895.HBHAL_5036 | ABC-type transport system permease protein (probable substrate cobalt/nickel). |
| CCG47372.1 protein network | https://string-db.org/network/866895.HBHAL_5037 | ABC-type transport system ATP-binding protein (probable substrate cobalt/nickel). |
| CCG47373.1 protein network | https://string-db.org/network/866895.HBHAL_5038 | Hypothetical protein. |
| CCG47374.1 protein network | https://string-db.org/network/866895.HBHAL_5039 | RpiR family transcription regulator. |
| mqo protein network | https://string-db.org/network/866895.HBHAL_5040 | Malate dehydrogenase (quinone). |
| CCG47376.1 protein network | https://string-db.org/network/866895.HBHAL_5041 | Aldo/keto reductase family protein. |
| CCG47377.1 protein network | https://string-db.org/network/866895.HBHAL_5042 | Hypothetical protein. |
| CCG47378.1 protein network | https://string-db.org/network/866895.HBHAL_5043 | Hypothetical protein. |
| CCG47379.1 protein network | https://string-db.org/network/866895.HBHAL_5044 | Hypothetical protein. |
| CCG47380.1 protein network | https://string-db.org/network/866895.HBHAL_5045 | Hypothetical protein. |
| cls1 protein network | https://string-db.org/network/866895.HBHAL_5046 | Cardiolipin synthetase; Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol. |
| CCG47382.1 protein network | https://string-db.org/network/866895.HBHAL_5047 | Conserved hypothetical protein. |
| CCG47383.1 protein network | https://string-db.org/network/866895.HBHAL_5048 | TetR family transcription regulator. |
| CCG47384.1 protein network | https://string-db.org/network/866895.HBHAL_5049 | MFS-type transporter. |
| CCG47385.1 protein network | https://string-db.org/network/866895.HBHAL_5050 | Hypothetical protein. |
| CCG47386.1 protein network | https://string-db.org/network/866895.HBHAL_5051 | Hypothetical protein. |
| CCG47387.1 protein network | https://string-db.org/network/866895.HBHAL_5052 | Hypothetical protein. |
| CCG47388.1 protein network | https://string-db.org/network/866895.HBHAL_5053 | SSS family transporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| CCG47389.1 protein network | https://string-db.org/network/866895.HBHAL_5054 | Conserved hypothetical protein. |
| lrgB protein network | https://string-db.org/network/866895.HBHAL_5055 | Hypothetical protein. |
| CCG47391.1 protein network | https://string-db.org/network/866895.HBHAL_5056 | Holin-like protein. |
| CCG47392.1 protein network | https://string-db.org/network/866895.HBHAL_5057 | Hypothetical protein. |
| CCG47393.1 protein network | https://string-db.org/network/866895.HBHAL_5058 | Diguanylate cyclase domain protein. |
| CCG47394.1 protein network | https://string-db.org/network/866895.HBHAL_5059 | Hypothetical protein. |
| CCG47395.1 protein network | https://string-db.org/network/866895.HBHAL_5060 | AB hydrolase superfamily protein. |
| CCG47397.1 protein network | https://string-db.org/network/866895.HBHAL_5062 | Homolog to ATP-dependent RNA helicase. |
| CCG47398.1 protein network | https://string-db.org/network/866895.HBHAL_5063 | Conserved hypothetical protein. |
| CCG47399.1 protein network | https://string-db.org/network/866895.HBHAL_5064 | Conserved hypothetical protein. |
| CCG47400.1 protein network | https://string-db.org/network/866895.HBHAL_5065 | Conserved hypothetical protein. |
| CCG47401.1 protein network | https://string-db.org/network/866895.HBHAL_5066 | Conserved hypothetical protein. |
| CCG47402.1 protein network | https://string-db.org/network/866895.HBHAL_5067 | Conserved hypothetical protein. |
| CCG47403.1 protein network | https://string-db.org/network/866895.HBHAL_5068 | Conserved hypothetical protein. |
| CCG47404.1 protein network | https://string-db.org/network/866895.HBHAL_5069 | Conserved hypothetical protein. |
| CCG47405.1 protein network | https://string-db.org/network/866895.HBHAL_5070 | Hypothetical protein. |
| CCG47406.1 protein network | https://string-db.org/network/866895.HBHAL_5071 | Hypothetical protein. |
| dnaC2 protein network | https://string-db.org/network/866895.HBHAL_5072 | Replicative DNA helicase; Participates in initiation and elongation during chromosome replication; it exhibits DNA-dependent ATPase activity. Belongs to the helicase family. DnaB subfamily. |
| CCG47408.1 protein network | https://string-db.org/network/866895.HBHAL_5073 | Hypothetical protein. |
| CCG47409.1 protein network | https://string-db.org/network/866895.HBHAL_5074 | Hypothetical protein. |
| yfjN protein network | https://string-db.org/network/866895.HBHAL_5076 | Hypothetical protein; Catalyzes the synthesis of 5,6-dihydrouridine (D), a modified base found in the D-loop of most tRNAs, via the reduction of the C5-C6 double bond in target uridines; Belongs [...] |
| CCG47413.1 protein network | https://string-db.org/network/866895.HBHAL_5078 | Hypothetical protein. |
| CCG47414.1 protein network | https://string-db.org/network/866895.HBHAL_5079 | Hypothetical protein. |
| CCG47415.1 protein network | https://string-db.org/network/866895.HBHAL_5079_A | Conserved hypothetical protein. |
| CCG47416.1 protein network | https://string-db.org/network/866895.HBHAL_5080 | Hypothetical protein. |
| CCG47417.1 protein network | https://string-db.org/network/866895.HBHAL_5081 | Hypothetical protein. |
| CCG47418.1 protein network | https://string-db.org/network/866895.HBHAL_5082 | Conserved hypothetical protein. |
| CCG47419.1 protein network | https://string-db.org/network/866895.HBHAL_5083 | Conserved hypothetical protein. |
| CCG47420.1 protein network | https://string-db.org/network/866895.HBHAL_5084 | Conserved hypothetical protein. |
| CCG47421.1 protein network | https://string-db.org/network/866895.HBHAL_5085 | Conserved hypothetical protein. |
| CCG47422.1 protein network | https://string-db.org/network/866895.HBHAL_5086 | Conserved hypothetical protein. |
| CCG47423.1 protein network | https://string-db.org/network/866895.HBHAL_5087 | Hypothetical protein. |
| CCG47424.1 protein network | https://string-db.org/network/866895.HBHAL_5088 | ABC-type transport system ATP-binding protein. |
| CCG47425.1 protein network | https://string-db.org/network/866895.HBHAL_5089 | ABC-type transport system permease protein. |
| HBHAL_5090 protein network | https://string-db.org/network/866895.HBHAL_5090 | Locus_tag: HBHAL_5089_A; product: conserved hypothetical protein (nonfunctional); gene has a frameshift; conceptual translation after in silico reconstruction: MNCHGHQRRIDLVKNYNIVPITHTRLLNGHQLSSC [...] |
| CCG47428.1 protein network | https://string-db.org/network/866895.HBHAL_5091 | Conserved hypothetical protein. |
| alr2 protein network | https://string-db.org/network/866895.HBHAL_5092 | Alanine racemase; Catalyzes the interconversion of L-alanine and D-alanine. May also act on other amino acids; Belongs to the alanine racemase family. |
| ald3 protein network | https://string-db.org/network/866895.HBHAL_5093 | Alanine dehydrogenase; Belongs to the AlaDH/PNT family. |
| yukF protein network | https://string-db.org/network/866895.HBHAL_5094 | Hypothetical protein. |
| CCG47432.1 protein network | https://string-db.org/network/866895.HBHAL_5095 | Hypothetical protein. |
| yydA protein network | https://string-db.org/network/866895.HBHAL_5096 | Conserved hypothetical protein; Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA; Belongs to the RNA methyltransferase RlmH family. |
| CCG47434.1 protein network | https://string-db.org/network/866895.HBHAL_5097 | Oxidoreductase. |
| CCG47435.1 protein network | https://string-db.org/network/866895.HBHAL_5098 | ABC-type transport system extracellular binding protein (probable substrate ribose). |
| CCG47436.1 protein network | https://string-db.org/network/866895.HBHAL_5099 | ABC-type transport system permease protein (probable substrate ribose); Belongs to the binding-protein-dependent transport system permease family. |
| rbsA protein network | https://string-db.org/network/866895.HBHAL_5100 | ABC-type transport system ATP-binding protein (probable substrate ribose); Part of the ABC transporter complex RbsABC involved in ribose import. Responsible for energy coupling to the transport s [...] |
| rbsD protein network | https://string-db.org/network/866895.HBHAL_5101 | High affinity ribose transport protein RbsD; Catalyzes the interconversion of beta-pyran and beta-furan forms of D-ribose. |
| rbsK protein network | https://string-db.org/network/866895.HBHAL_5102 | Ribokinase; Catalyzes the phosphorylation of ribose at O-5 in a reaction requiring ATP and magnesium. The resulting D-ribose-5-phosphate can then be used either for sythesis of nucleotides, histi [...] |
| rbsR protein network | https://string-db.org/network/866895.HBHAL_5103 | LacI family ribose operon repressor. |
| CCG47441.1 protein network | https://string-db.org/network/866895.HBHAL_5104 | M48 family peptidase. |
| CCG47442.1 protein network | https://string-db.org/network/866895.HBHAL_5105 | Hypothetical protein. |
| CCG47443.1 protein network | https://string-db.org/network/866895.HBHAL_5106 | NUDIX family hydrolase; Belongs to the Nudix hydrolase family. |
| mtnN3 protein network | https://string-db.org/network/866895.HBHAL_5109 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase (nonfunctional). |
| CCG47446.1 protein network | https://string-db.org/network/866895.HBHAL_5110 | Hypothetical protein. |
| CCG47447.1 protein network | https://string-db.org/network/866895.HBHAL_5111 | Hypothetical protein. |
| CCG47448.1 protein network | https://string-db.org/network/866895.HBHAL_5112 | Hypothetical protein. |
| gly1 protein network | https://string-db.org/network/866895.HBHAL_5113 | Threonine aldolase. |
| CCG47450.1 protein network | https://string-db.org/network/866895.HBHAL_5114 | Conserved hypothetical protein. |
| yyxA protein network | https://string-db.org/network/866895.HBHAL_5115 | Serine protease. |
| yycJ protein network | https://string-db.org/network/866895.HBHAL_5116 | Hypothetical protein. |
| CCG47453.1 protein network | https://string-db.org/network/866895.HBHAL_5117 | Hypothetical protein. |
| yycH protein network | https://string-db.org/network/866895.HBHAL_5118 | Hypothetical protein. |
| CCG47455.1 protein network | https://string-db.org/network/866895.HBHAL_5119 | Two-component sensor histidine kinase. |
| CCG47456.1 protein network | https://string-db.org/network/866895.HBHAL_5120 | Two-component response regulator. |
| CCG47457.1 protein network | https://string-db.org/network/866895.HBHAL_5121 | M23 family peptidase. |
| CCG47458.1 protein network | https://string-db.org/network/866895.HBHAL_5122 | Hypothetical protein. |
| CCG47459.1 protein network | https://string-db.org/network/866895.HBHAL_5123 | Hypothetical protein. |
| CCG47460.1 protein network | https://string-db.org/network/866895.HBHAL_5124 | Putative decarboxylase; Belongs to the LOG family. |
| purA protein network | https://string-db.org/network/866895.HBHAL_5125 | Adenylosuccinate synthetase; Plays an important role in the de novo pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP; Belongs to t [...] |
| CCG47462.1 protein network | https://string-db.org/network/866895.HBHAL_5126 | DeoR family transcription regulator. |
| ywpJ protein network | https://string-db.org/network/866895.HBHAL_5127 | Probable phosphatase YwpJ. |
| dnaC1 protein network | https://string-db.org/network/866895.HBHAL_5129 | Replicative DNA helicase; Participates in initiation and elongation during chromosome replication; it exhibits DNA-dependent ATPase activity. Belongs to the helicase family. DnaB subfamily. |
| rplI protein network | https://string-db.org/network/866895.HBHAL_5130 | 50S ribosomal protein L9; Binds to the 23S rRNA. |
| yybT protein network | https://string-db.org/network/866895.HBHAL_5131 | DHH subfamily 1 protein; Has phosphodiesterase (PDE) activity against cyclic-di-AMP (c-di-AMP); Belongs to the GdpP/PdeA phosphodiesterase family. |
| CCG47468.1 protein network | https://string-db.org/network/866895.HBHAL_5132 | Hypothetical protein. |
| hisJ2 protein network | https://string-db.org/network/866895.HBHAL_5133 | Histidinol-phosphatase; Belongs to the PHP hydrolase family. HisK subfamily. |
| CCG47470.1 protein network | https://string-db.org/network/866895.HBHAL_5134 | AbgT family protein. |
| CCG47471.1 protein network | https://string-db.org/network/866895.HBHAL_5135 | Putative oxidoreductase. |
| serA protein network | https://string-db.org/network/866895.HBHAL_5136 | Phosphoglycerate dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. |
| CCG47473.1 protein network | https://string-db.org/network/866895.HBHAL_5137 | Aminotransferase. |
| CCG47474.1 protein network | https://string-db.org/network/866895.HBHAL_5138 | ABC-type transport system extracellular binding protein (probable substrate peptide/nickel). |
| yyaS1 protein network | https://string-db.org/network/866895.HBHAL_5139 | Conserved hypothetical protein. |
| hmp protein network | https://string-db.org/network/866895.HBHAL_5140 | Nitric oxide dioxygenase; Is involved in NO detoxification in an aerobic process, termed nitric oxide dioxygenase (NOD) reaction that utilizes O(2) and NAD(P)H to convert NO to nitrate, which pro [...] |
| nsrR protein network | https://string-db.org/network/866895.HBHAL_5141 | Transcription regulator NsrR. |
| rpsR protein network | https://string-db.org/network/866895.HBHAL_5142 | 30S ribosomal protein S18; Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit; Belongs to the bacterial ribosom [...] |
| ssb protein network | https://string-db.org/network/866895.HBHAL_5143 | Single-strand DNA-binding protein; Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of actio [...] |
| rpsF protein network | https://string-db.org/network/866895.HBHAL_5144 | 30S ribosomal protein S6; Binds together with S18 to 16S ribosomal RNA. |
| ychF protein network | https://string-db.org/network/866895.HBHAL_5145 | Translation-associated GTPase; ATPase that binds to both the 70S ribosome and the 50S ribosomal subunit in a nucleotide-independent manner. |
| CCG47482.1 protein network | https://string-db.org/network/866895.HBHAL_5146 | Hypothetical protein. |
| CCG47483.1 protein network | https://string-db.org/network/866895.HBHAL_5147 | Small-conductance mechanosensitive channel. |
| yyaD protein network | https://string-db.org/network/866895.HBHAL_5148 | Hypothetical protein. |
| CCG47485.1 protein network | https://string-db.org/network/866895.HBHAL_5149 | Conserved hypothetical protein. |
| ydfK protein network | https://string-db.org/network/866895.HBHAL_5150 | Conserved hypothetical protein. |
| CCG47487.1 protein network | https://string-db.org/network/866895.HBHAL_5151 | Stage 0 sporulation protein J; Belongs to the ParB family. |
| noc protein network | https://string-db.org/network/866895.HBHAL_5152 | Nucleoid occlusion protein; Effects nucleoid occlusion by binding relatively nonspecifically to DNA and preventing the assembly of the division machinery in the vicinity of the nucleoid, especial [...] |
| CCG47489.1 protein network | https://string-db.org/network/866895.HBHAL_5153 | Hypothetical protein. |
| CCG47490.1 protein network | https://string-db.org/network/866895.HBHAL_5154 | MFS-type transporter. |
| prtV protein network | https://string-db.org/network/866895.HBHAL_5155 | M6 family peptidase. |
| CCG47492.1 protein network | https://string-db.org/network/866895.HBHAL_5156 | Two-component response regulator. |
| CCG47493.1 protein network | https://string-db.org/network/866895.HBHAL_5157 | Two-component sensor histidine kinase. |
| CCG47494.1 protein network | https://string-db.org/network/866895.HBHAL_5158 | ABC-type transport system permease protein (probable substrate antibiotic). |
| CCG47495.1 protein network | https://string-db.org/network/866895.HBHAL_5159 | ABC-type transport system ATP-binding protein (probable substrate antibiotic). |
| CCG47496.1 protein network | https://string-db.org/network/866895.HBHAL_5160 | Acetyltransferase, GNAT family. |
| CCG47497.1 protein network | https://string-db.org/network/866895.HBHAL_5161 | Conserved hypothetical protein. |
| CCG47498.1 protein network | https://string-db.org/network/866895.HBHAL_5162 | Spore photoproduct lyase. |
| CCG47499.1 protein network | https://string-db.org/network/866895.HBHAL_5163 | Short-chain dehydrogenase/reductase family protein. |
| nei protein network | https://string-db.org/network/866895.HBHAL_5164 | Endonuclease VIII. |
| CCG47501.1 protein network | https://string-db.org/network/866895.HBHAL_5165 | Probable phosphoesterase. |
| gidB protein network | https://string-db.org/network/866895.HBHAL_5166 | Glucose-inhibited division protein B; Specifically methylates the N7 position of guanine in position 535 of 16S rRNA; Belongs to the methyltransferase superfamily. RNA methyltransferase RsmG fami [...] |
| gidA protein network | https://string-db.org/network/866895.HBHAL_5167 | tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; NAD-binding protein involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain t [...] |
| mnmE protein network | https://string-db.org/network/866895.HBHAL_5168 | tRNA modification GTPase TrmE; Exhibits a very high intrinsic GTPase hydrolysis rate. Involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain t [...] |
| jag protein network | https://string-db.org/network/866895.HBHAL_5170 | Protein Jag. |
| yidC-2 protein network | https://string-db.org/network/866895.HBHAL_5171 | OxaA-like protein precursor; Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane protein [...] |
| rnpA protein network | https://string-db.org/network/866895.HBHAL_5172 | Ribonuclease P; RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein compo [...] |
| rpmH protein network | https://string-db.org/network/866895.HBHAL_5173 | 50S ribosomal protein L34; Belongs to the bacterial ribosomal protein bL34 family. |