| oapC protein network | https://string-db.org/network/268739.Nmlp_1001 | Origin-associated protein OapC. |
| oapB protein network | https://string-db.org/network/268739.Nmlp_1002 | Origin-associated protein OapB. |
| oapA protein network | https://string-db.org/network/268739.Nmlp_1003 | Origin-associated GTP-binding protein OapA. |
| orc1 protein network | https://string-db.org/network/268739.Nmlp_1004 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. |
| Nmlp_1005 protein network | https://string-db.org/network/268739.Nmlp_1005 | Uncharacterized protein. |
| Nmlp_1007 protein network | https://string-db.org/network/268739.Nmlp_1007 | Alpha/beta hydrolase fold protein. |
| sufS2 protein network | https://string-db.org/network/268739.Nmlp_1008 | Probable cysteine desulfurase. |
| Nmlp_1009 protein network | https://string-db.org/network/268739.Nmlp_1009 | Small CPxCG-related zinc finger protein. |
| Nmlp_1010 protein network | https://string-db.org/network/268739.Nmlp_1010 | Small CPxCG-related zinc finger protein. |
| rpiA protein network | https://string-db.org/network/268739.Nmlp_1011 | Ribose-5-phosphate isomerase; Catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate. |
| Nmlp_1012 protein network | https://string-db.org/network/268739.Nmlp_1012 | IS1341-type transposase ISNamo20. |
| Nmlp_1013 protein network | https://string-db.org/network/268739.Nmlp_1013 | Uncharacterized protein. |
| purE2 protein network | https://string-db.org/network/268739.Nmlp_1014 | PurE family protein. |
| Nmlp_1015 protein network | https://string-db.org/network/268739.Nmlp_1015 | Small CPxCG-related zinc finger protein. |
| Nmlp_1016 protein network | https://string-db.org/network/268739.Nmlp_1016 | UPF0213 family protein. |
| amzA protein network | https://string-db.org/network/268739.Nmlp_1017 | Archaemetzincin; Probable zinc metalloprotease whose natural substrate is unknown. |
| Nmlp_1018 protein network | https://string-db.org/network/268739.Nmlp_1018 | UPF0146 family protein; Belongs to the UPF0146 family. |
| Nmlp_1019 protein network | https://string-db.org/network/268739.Nmlp_1019 | HAD superfamily hydrolase. |
| npdG protein network | https://string-db.org/network/268739.Nmlp_1020 | F420H2:NADP oxidoreductase. |
| Nmlp_1021 protein network | https://string-db.org/network/268739.Nmlp_1021 | PrsW family protein. |
| aubA protein network | https://string-db.org/network/268739.Nmlp_1022 | RNA-binding protein AU-1; Probable RNase involved in rRNA stability through maturation and/or degradation of precursor rRNAs. Binds to RNA in loop regions with AU-rich sequences. |
| Nmlp_1023 protein network | https://string-db.org/network/268739.Nmlp_1023 | Stomatin family protein. |
| Nmlp_1024 protein network | https://string-db.org/network/268739.Nmlp_1024 | Uncharacterized protein. |
| Nmlp_1025 protein network | https://string-db.org/network/268739.Nmlp_1025 | Major facilitator superfamily transport protein. |
| pyrD protein network | https://string-db.org/network/268739.Nmlp_1026 | Dihydroorotate dehydrogenase (quinone); Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor; Belongs to the dihydroorotate dehydrogenase family. Type 2 subfami [...] |
| Nmlp_1027 protein network | https://string-db.org/network/268739.Nmlp_1027 | Uncharacterized protein. |
| Nmlp_1028 protein network | https://string-db.org/network/268739.Nmlp_1028 | Nonhistone chromosomal protein. |
| Nmlp_1029 protein network | https://string-db.org/network/268739.Nmlp_1029 | Uncharacterized protein. |
| ridA protein network | https://string-db.org/network/268739.Nmlp_1030 | Enamine/imine deaminase. |
| Nmlp_1031 protein network | https://string-db.org/network/268739.Nmlp_1031 | DEAD/DEAH box helicase. |
| lipA protein network | https://string-db.org/network/268739.Nmlp_1032 | Lipoate synthase; Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, ther [...] |
| Nmlp_1033 protein network | https://string-db.org/network/268739.Nmlp_1033 | Acetyltransferase domain protein. |
| lysC protein network | https://string-db.org/network/268739.Nmlp_1034 | Aspartate kinase; Belongs to the aspartokinase family. |
| Nmlp_1035 protein network | https://string-db.org/network/268739.Nmlp_1035 | TIGR00725 family protein. |
| Nmlp_1036 protein network | https://string-db.org/network/268739.Nmlp_1036 | ABC-type transport system ATP-binding/permease protein. |
| ipp2 protein network | https://string-db.org/network/268739.Nmlp_1037 | Inorganic pyrophosphatase; Catalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions. |
| Nmlp_1038 protein network | https://string-db.org/network/268739.Nmlp_1038 | Uncharacterized protein. |
| cbiA protein network | https://string-db.org/network/268739.Nmlp_1039 | Cobyrinate a,c-diamide synthase. |
| cobT protein network | https://string-db.org/network/268739.Nmlp_1040 | Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase; Belongs to the UPF0284 family. |
| Nmlp_1041 protein network | https://string-db.org/network/268739.Nmlp_1041 | UPF0104 family protein. |
| gtl6 protein network | https://string-db.org/network/268739.Nmlp_1042 | Probable glycosyltransferase, type 2. |
| Nmlp_1043 protein network | https://string-db.org/network/268739.Nmlp_1043 | AlkP-core domain protein. |
| cbiE protein network | https://string-db.org/network/268739.Nmlp_1044 | Cobalt-precorrin-7 C5-methyltransferase. |
| cbiC protein network | https://string-db.org/network/268739.Nmlp_1045 | Cobalt-precorrin-8 methylmutase. |
| cobN protein network | https://string-db.org/network/268739.Nmlp_1046 | ATP-dependent cobaltochelatase subunit CobN. |
| chlID protein network | https://string-db.org/network/268739.Nmlp_1047 | ATP-dependent cobaltochelatase subunit ChlID. |
| Nmlp_1048 protein network | https://string-db.org/network/268739.Nmlp_1048 | CbtB family protein. |
| Nmlp_1049 protein network | https://string-db.org/network/268739.Nmlp_1049 | CbtA family protein. |
| Nmlp_1050 protein network | https://string-db.org/network/268739.Nmlp_1050 | Thioredoxin domain protein. |
| Nmlp_1051 protein network | https://string-db.org/network/268739.Nmlp_1051 | Uncharacterized protein. |
| rtcB2 protein network | https://string-db.org/network/268739.Nmlp_1052 | tRNA-splicing ligase RtcB. |
| aspC4 protein network | https://string-db.org/network/268739.Nmlp_1053 | Pyridoxal phosphate-dependent aminotransferase. |
| Nmlp_1054 protein network | https://string-db.org/network/268739.Nmlp_1054 | GNAT family acetyltransferase. |
| Nmlp_1055 protein network | https://string-db.org/network/268739.Nmlp_1055 | Uncharacterized protein. |
| Nmlp_1056 protein network | https://string-db.org/network/268739.Nmlp_1056 | DUF302 family protein. |
| Nmlp_1057 protein network | https://string-db.org/network/268739.Nmlp_1057 | Uncharacterized protein. |
| Nmlp_1058 protein network | https://string-db.org/network/268739.Nmlp_1058 | Uncharacterized protein. |
| Nmlp_1059 protein network | https://string-db.org/network/268739.Nmlp_1059 | Uncharacterized protein. |
| Nmlp_1060 protein network | https://string-db.org/network/268739.Nmlp_1060 | 4-phosphopantoate--beta-alanine ligase. |
| Nmlp_1061 protein network | https://string-db.org/network/268739.Nmlp_1061 | Uncharacterized protein. |
| Nmlp_1062 protein network | https://string-db.org/network/268739.Nmlp_1062 | DUF82 family protein. |
| polX protein network | https://string-db.org/network/268739.Nmlp_1063 | DNA-directed DNA polymerase X. |
| Nmlp_1064 protein network | https://string-db.org/network/268739.Nmlp_1064 | Uncharacterized protein. |
| ubaA protein network | https://string-db.org/network/268739.Nmlp_1065 | SAMP-activating enzyme E1. |
| hcp4 protein network | https://string-db.org/network/268739.Nmlp_1066 | Halocyanin. |
| msrB protein network | https://string-db.org/network/268739.Nmlp_1067 | Peptide methionine sulfoxide reductase MsrB (R-form specific). |
| Nmlp_1068 protein network | https://string-db.org/network/268739.Nmlp_1068 | Uncharacterized protein. |
| cat1 protein network | https://string-db.org/network/268739.Nmlp_1069 | Transport protein (probable substrate cationic amino acids). |
| Nmlp_1071 protein network | https://string-db.org/network/268739.Nmlp_1071 | UspA domain protein. |
| msrA1 protein network | https://string-db.org/network/268739.Nmlp_1072 | Peptide methionine sulfoxide reductase MsrA (S-form specific); Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidatio [...] |
| Nmlp_1073 protein network | https://string-db.org/network/268739.Nmlp_1073 | UspA domain protein. |
| Nmlp_1074 protein network | https://string-db.org/network/268739.Nmlp_1074 | Uncharacterized protein. |
| azf protein network | https://string-db.org/network/268739.Nmlp_1075 | Glucose-6-phosphate 1-dehydrogenase (NAD); Catalyzes the NAD-dependent oxidation of glucose 6-phosphate to 6-phosphogluconolactone; Belongs to the NAD(P)-dependent epimerase/dehydratase family. |
| Nmlp_1076 protein network | https://string-db.org/network/268739.Nmlp_1076 | Small CPxCG-related zinc finger protein. |
| Nmlp_1077 protein network | https://string-db.org/network/268739.Nmlp_1077 | ABC-type transport system permease protein (probable substrate macrolides). |
| Nmlp_1078 protein network | https://string-db.org/network/268739.Nmlp_1078 | ABC-type transport system ATP-binding protein (probable substrate macrolides). |
| Nmlp_1079 protein network | https://string-db.org/network/268739.Nmlp_1079 | Uncharacterized protein. |
| Nmlp_1080 protein network | https://string-db.org/network/268739.Nmlp_1080 | DUF309 family protein. |
| Nmlp_1081 protein network | https://string-db.org/network/268739.Nmlp_1081 | GNAT family acetyltransferase. |
| samp2 protein network | https://string-db.org/network/268739.Nmlp_1082 | Ubiquitin-like modifier protein SAMP2. |
| Nmlp_1083 protein network | https://string-db.org/network/268739.Nmlp_1083 | DUF583 domain protein. |
| rfcA protein network | https://string-db.org/network/268739.Nmlp_1084 | Replication factor C small subunit; Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA; Belongs to the activator 1 small subunits family. RfcS subfamily. |
| Nmlp_1085 protein network | https://string-db.org/network/268739.Nmlp_1085 | Helicase domain protein. |
| Nmlp_1086 protein network | https://string-db.org/network/268739.Nmlp_1086 | Major facilitator superfamily transport protein. |
| Nmlp_1087 protein network | https://string-db.org/network/268739.Nmlp_1087 | Pyridoxal phosphate-dependent aminotransferase. |
| ligA protein network | https://string-db.org/network/268739.Nmlp_1088 | DNA ligase (NAD); DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double- stranded DNA using NAD as a coenzyme and as the energy [...] |
| Nmlp_1089 protein network | https://string-db.org/network/268739.Nmlp_1089 | Uncharacterized protein. |
| radA protein network | https://string-db.org/network/268739.Nmlp_1090 | DNA repair and recombination protein RadA; Involved in DNA repair and in homologous recombination. Binds and assemble on single-stranded DNA to form a nucleoprotein filament. Hydrolyzes ATP in a [...] |
| Nmlp_1091 protein network | https://string-db.org/network/268739.Nmlp_1091 | Uncharacterized protein. |
| Nmlp_1092 protein network | https://string-db.org/network/268739.Nmlp_1092 | FMN-binding domain protein. |
| rnr protein network | https://string-db.org/network/268739.Nmlp_1093 | Ribonuclease R. |
| Nmlp_1094 protein network | https://string-db.org/network/268739.Nmlp_1094 | Small CPxCG-related zinc finger protein. |
| pepB2 protein network | https://string-db.org/network/268739.Nmlp_1095 | Aminopeptidase (homolog to leucyl aminopeptidase. |
| Nmlp_1096 protein network | https://string-db.org/network/268739.Nmlp_1096 | IS1341-type transposase ISNamo20. |
| fdfT protein network | https://string-db.org/network/268739.Nmlp_1097 | Squalene synthase. |
| CoaE protein network | https://string-db.org/network/268739.Nmlp_1098 | UPF0200 family protein. |
| Nmlp_1099 protein network | https://string-db.org/network/268739.Nmlp_1099 | UPF0201 family protein; Belongs to the UPF0201 family. |
| Nmlp_1100 protein network | https://string-db.org/network/268739.Nmlp_1100 | Stomatin family protein. |
| Nmlp_1101 protein network | https://string-db.org/network/268739.Nmlp_1101 | HTH domain protein. |
| Nmlp_1102 protein network | https://string-db.org/network/268739.Nmlp_1102 | Uncharacterized protein. |
| Nmlp_1103 protein network | https://string-db.org/network/268739.Nmlp_1103 | TRAM domain protein. |
| Nmlp_1104 protein network | https://string-db.org/network/268739.Nmlp_1104 | Uncharacterized protein. |
| Nmlp_1105 protein network | https://string-db.org/network/268739.Nmlp_1105 | Uncharacterized protein. |
| pabB protein network | https://string-db.org/network/268739.Nmlp_1106 | Aminodeoxychorismate synthase component 1. |
| pabA protein network | https://string-db.org/network/268739.Nmlp_1107 | Aminodeoxychorismate synthase component 2. |
| pabC protein network | https://string-db.org/network/268739.Nmlp_1108 | Aminodeoxychorismate lyase; Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family. |
| Nmlp_1109 protein network | https://string-db.org/network/268739.Nmlp_1109 | Probable iron-sulfur protein (2Fe-2S). |
| Nmlp_1110 protein network | https://string-db.org/network/268739.Nmlp_1110 | Sensor/bat box HTH-10 family transcription regulator. |
| maeB1 protein network | https://string-db.org/network/268739.Nmlp_1111 | Malate dehydrogenase (oxaloacetate-decarboxylating). |
| ark protein network | https://string-db.org/network/268739.Nmlp_1112 | Receiver/sensor box histidine kinase. |
| Nmlp_1113 protein network | https://string-db.org/network/268739.Nmlp_1113 | Major facilitator superfamily transport protein. |
| Nmlp_1114 protein network | https://string-db.org/network/268739.Nmlp_1114 | DUF81 family protein. |
| trm1 protein network | https://string-db.org/network/268739.Nmlp_1115 | tRNA (guanine(26)-N(2))-dimethyltransferase; Dimethylates a single guanine residue at position 26 of a number of tRNAs using S-adenosyl-L-methionine as donor of the methyl groups; Belongs to the [...] |
| Nmlp_1116 protein network | https://string-db.org/network/268739.Nmlp_1116 | AbrB family transcription regulator. |
| Nmlp_1117 protein network | https://string-db.org/network/268739.Nmlp_1117 | Uncharacterized protein. |
| cxp1 protein network | https://string-db.org/network/268739.Nmlp_1118 | Metal-dependent carboxypeptidase; Broad specificity carboxypetidase that releases amino acids sequentially from the C-terminus, including neutral, aromatic, polar and basic residues. |
| Nmlp_1119 protein network | https://string-db.org/network/268739.Nmlp_1119 | arNOG04375 family protein (homolog to PilT-type ATPase). |
| Nmlp_1120 protein network | https://string-db.org/network/268739.Nmlp_1120 | Uncharacterized protein. |
| adkA protein network | https://string-db.org/network/268739.Nmlp_1121 | Adenylate kinase (ATP-AMP transphosphorylase),archaeal-type; Belongs to the archaeal adenylate kinase family. |
| Nmlp_1122 protein network | https://string-db.org/network/268739.Nmlp_1122 | FAD-dependent oxidoreductase (GlcD/DLD_GlcF/GlpC domain fusion protein). |
| Nmlp_1123 protein network | https://string-db.org/network/268739.Nmlp_1123 | Uncharacterized protein. |
| Nmlp_1124 protein network | https://string-db.org/network/268739.Nmlp_1124 | SWIM zinc finger domain protein. |
| tbp1 protein network | https://string-db.org/network/268739.Nmlp_1125 | TATA-binding transcription initiation factor; General factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Binds specifically to the TATA box promoter eleme [...] |
| Nmlp_1127 protein network | https://string-db.org/network/268739.Nmlp_1127 | Lactate 2-monooxygenase. |
| hisG protein network | https://string-db.org/network/268739.Nmlp_1128 | ATP phosphoribosyltransferase; Catalyzes the condensation of ATP and 5-phosphoribose 1- diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP). Has a crucial role in the pathway because the rate [...] |
| Nmlp_1129 protein network | https://string-db.org/network/268739.Nmlp_1129 | Protein kinase domain protein. |
| Nmlp_1130 protein network | https://string-db.org/network/268739.Nmlp_1130 | Uncharacterized protein. |
| Nmlp_1131 protein network | https://string-db.org/network/268739.Nmlp_1131 | Small CPxCG-related zinc finger protein. |
| Nmlp_1132 protein network | https://string-db.org/network/268739.Nmlp_1132 | Uncharacterized protein. |
| mer protein network | https://string-db.org/network/268739.Nmlp_1133 | Probable 5,10-methylenetetrahydrofolate reductase; Catalyzes the oxidation of methyl-H(4)MPT to methylene- H(4)MPT. |
| cofE protein network | https://string-db.org/network/268739.Nmlp_1134 | Coenzyme F420:L-glutamate ligase; Catalyzes the GTP-dependent successive addition of two or more gamma-linked L-glutamates to the L-lactyl phosphodiester of 7,8- didemethyl-8-hydroxy-5-deazaribof [...] |
| aroE protein network | https://string-db.org/network/268739.Nmlp_1135 | Shikimate dehydrogenase; Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshiki [...] |
| dtdA protein network | https://string-db.org/network/268739.Nmlp_1136 | D-aminoacyl-tRNA deacylase; D-aminoacyl-tRNA deacylase with broad substrate specificity. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxici [...] |
| cysA protein network | https://string-db.org/network/268739.Nmlp_1137 | ABC-type transport system ATP-binding protein (probable substrate sulfate/thiosulfate/molybdate). |
| Nmlp_1138 protein network | https://string-db.org/network/268739.Nmlp_1138 | ABC-type transport system permease protein (probable substrate sulfate/thiosulfate/molybdate). |
| Nmlp_1139 protein network | https://string-db.org/network/268739.Nmlp_1139 | ABC-type transport system periplasmic substrate-binding protein (probable substrate sulfate/thiosulfate/molybdate). |
| Nmlp_1140 protein network | https://string-db.org/network/268739.Nmlp_1140 | Uncharacterized protein. |
| Nmlp_1141 protein network | https://string-db.org/network/268739.Nmlp_1141 | Uncharacterized protein. |
| Nmlp_1142 protein network | https://string-db.org/network/268739.Nmlp_1142 | UPF0395 family protein. |
| Nmlp_1143 protein network | https://string-db.org/network/268739.Nmlp_1143 | UPF0395 family protein. |
| Nmlp_1144 protein network | https://string-db.org/network/268739.Nmlp_1144 | Uncharacterized protein. |
| Nmlp_1146 protein network | https://string-db.org/network/268739.Nmlp_1146 | Nucleotidyltransferase domain protein; Product: uncharacterized protein (nonfunctional). |
| Nmlp_1147 protein network | https://string-db.org/network/268739.Nmlp_1147 | Uncharacterized protein. |
| Nmlp_1148 protein network | https://string-db.org/network/268739.Nmlp_1148 | RelE family protein. |
| Nmlp_1149 protein network | https://string-db.org/network/268739.Nmlp_1149 | Uncharacterized protein. |
| Nmlp_1150 protein network | https://string-db.org/network/268739.Nmlp_1150 | Uncharacterized protein. |
| Nmlp_1151 protein network | https://string-db.org/network/268739.Nmlp_1151 | Uncharacterized protein. |
| Nmlp_1152 protein network | https://string-db.org/network/268739.Nmlp_1152 | Probable secreted glycoprotein. |
| ftsZ1 protein network | https://string-db.org/network/268739.Nmlp_1153 | Cell division protein FtsZ, type I; Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls [...] |
| secE protein network | https://string-db.org/network/268739.Nmlp_1154 | Protein translocase subunit SecE; Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. |
| spt5 protein network | https://string-db.org/network/268739.Nmlp_1155 | Transcription elongation factor Spt5; Stimulates transcription elongation; Belongs to the archaeal Spt5 family. |
| Nmlp_1156 protein network | https://string-db.org/network/268739.Nmlp_1156 | PHP domain protein. |
| Nmlp_1157 protein network | https://string-db.org/network/268739.Nmlp_1157 | DUF457 family protein. |
| CinA3 protein network | https://string-db.org/network/268739.Nmlp_1158 | Nicotinamide mononucleotide deamidase. |
| hisB protein network | https://string-db.org/network/268739.Nmlp_1159 | Imidazoleglycerol-phosphate dehydratase. |
| Nmlp_1160 protein network | https://string-db.org/network/268739.Nmlp_1160 | Uncharacterized protein. |
| hemQ protein network | https://string-db.org/network/268739.Nmlp_1161 | Heme-binding protein HemQ. |
| Nmlp_1162 protein network | https://string-db.org/network/268739.Nmlp_1162 | Uncharacterized protein. |
| Nmlp_1163 protein network | https://string-db.org/network/268739.Nmlp_1163 | Uncharacterized protein. |
| Nmlp_1164 protein network | https://string-db.org/network/268739.Nmlp_1164 | M50 family metalloprotease. |
| lysS protein network | https://string-db.org/network/268739.Nmlp_1165 | lysine--tRNA ligase; Belongs to the class-I aminoacyl-tRNA synthetase family. |
| pyrH protein network | https://string-db.org/network/268739.Nmlp_1166 | Uridylate kinase; Catalyzes the reversible phosphorylation of UMP to UDP. |
| moaE protein network | https://string-db.org/network/268739.Nmlp_1167 | Molybdopterin synthase catalytic subunit. |
| Nmlp_1168 protein network | https://string-db.org/network/268739.Nmlp_1168 | Uncharacterized protein. |
| Nmlp_1169 protein network | https://string-db.org/network/268739.Nmlp_1169 | M50 family metalloprotease. |
| thiL protein network | https://string-db.org/network/268739.Nmlp_1170 | Thiamine-monophosphate kinase; Catalyzes the ATP-dependent phosphorylation of thiamine- monophosphate (TMP) to form thiamine-pyrophosphate (TPP), the active form of vitamin B1; Belongs to the thi [...] |
| rps19e protein network | https://string-db.org/network/268739.Nmlp_1171 | 30S ribosomal protein S19e; May be involved in maturation of the 30S ribosomal subunit. Belongs to the eukaryotic ribosomal protein eS19 family. |
| Nmlp_1172 protein network | https://string-db.org/network/268739.Nmlp_1172 | TIGR03663 family protein. |
| purK protein network | https://string-db.org/network/268739.Nmlp_1173 | 5-(carboxyamino)imidazole ribonucleotide synthase; Catalyzes the ATP-dependent conversion of 5-aminoimidazole ribonucleotide (AIR) and HCO(3)(-) to N5-carboxyaminoimidazole ribonucleotide (N5-CAI [...] |
| nosL1 protein network | https://string-db.org/network/268739.Nmlp_1174 | NosL family protein. |
| purE1 protein network | https://string-db.org/network/268739.Nmlp_1175 | N5-carboxyaminoimidazole ribonucleotide mutase; Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR). |
| taw2 protein network | https://string-db.org/network/268739.Nmlp_1176 | tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase; S-adenosyl-L-methionine-dependent transferase that acts as a component of the wyosine derivatives biosynthesis pathway. Catal [...] |
| Nmlp_1177 protein network | https://string-db.org/network/268739.Nmlp_1177 | NMD3 family protein. |
| Nmlp_1178 protein network | https://string-db.org/network/268739.Nmlp_1178 | Major facilitator superfamily transport protein. |
| ribE protein network | https://string-db.org/network/268739.Nmlp_1179 | Riboflavin synthase. |
| Nmlp_1180 protein network | https://string-db.org/network/268739.Nmlp_1180 | Uncharacterized protein. |
| Nmlp_1181 protein network | https://string-db.org/network/268739.Nmlp_1181 | Uncharacterized protein. |
| truA protein network | https://string-db.org/network/268739.Nmlp_1182 | tRNA pseudouridine synthase TruA. |
| pepF protein network | https://string-db.org/network/268739.Nmlp_1183 | Oligoendopeptidase PepF. |
| pan1 protein network | https://string-db.org/network/268739.Nmlp_1184 | Proteasome-activating nucleotidase; ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is esse [...] |
| Nmlp_1185 protein network | https://string-db.org/network/268739.Nmlp_1185 | Uncharacterized protein. |
| Nmlp_1186 protein network | https://string-db.org/network/268739.Nmlp_1186 | Small CPxCG-related zinc finger protein. |
| ilvE1 protein network | https://string-db.org/network/268739.Nmlp_1187 | Branched-chain amino acid aminotransferase; Acts on leucine, isoleucine and valine. Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family. |
| menG protein network | https://string-db.org/network/268739.Nmlp_1188 | Probable demethylmenaquinone methyltransferase. |
| Nmlp_1189 protein network | https://string-db.org/network/268739.Nmlp_1189 | DUF1628 domain protein. |
| Nmlp_1190 protein network | https://string-db.org/network/268739.Nmlp_1190 | Uncharacterized protein. |
| Nmlp_1191 protein network | https://string-db.org/network/268739.Nmlp_1191 | Probable transmembrane glycoprotein / HTH domain protein. |
| etfB protein network | https://string-db.org/network/268739.Nmlp_1192 | Electron transfer flavoprotein beta subunit. |
| etfA protein network | https://string-db.org/network/268739.Nmlp_1193 | Electron transfer flavoprotein alpha subunit. |
| trpC protein network | https://string-db.org/network/268739.Nmlp_1194 | Indole-3-glycerol-phosphate synthase; Belongs to the TrpC family. |
| trpB1 protein network | https://string-db.org/network/268739.Nmlp_1195 | Tryptophan synthase beta subunit; The beta subunit is responsible for the synthesis of L- tryptophan from indole and L-serine. |
| trpA protein network | https://string-db.org/network/268739.Nmlp_1196 | Tryptophan synthase alpha subunit; The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate. Belongs to the TrpA family. |
| fba2 protein network | https://string-db.org/network/268739.Nmlp_1197 | 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase. |
| cspA4 protein network | https://string-db.org/network/268739.Nmlp_1198 | Cold shock protein. |
| Nmlp_1200 protein network | https://string-db.org/network/268739.Nmlp_1200 | HTH-10 family transcription regulator. |
| aroB protein network | https://string-db.org/network/268739.Nmlp_1201 | 3-dehydroquinate synthase, type II; Catalyzes the oxidative deamination and cyclization of 2- amino-3,7-dideoxy-D-threo-hept-6-ulosonic acid (ADH) to yield 3- dehydroquinate (DHQ), which is fed i [...] |
| aroD protein network | https://string-db.org/network/268739.Nmlp_1202 | 3-dehydroquinate dehydratase; Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis- dehydration of 3-dehydroquinate (DH [...] |
| Nmlp_1203 protein network | https://string-db.org/network/268739.Nmlp_1203 | TRAM domain protein. |
| aglD protein network | https://string-db.org/network/268739.Nmlp_1204 | Glycosyltransferase AglD. |
| Nmlp_1205 protein network | https://string-db.org/network/268739.Nmlp_1205 | PQQ repeat protein. |
| LctP1 protein network | https://string-db.org/network/268739.Nmlp_1206 | LctP family transport protein. |
| Nmlp_1207 protein network | https://string-db.org/network/268739.Nmlp_1207 | HTH domain protein. |
| LctP2 protein network | https://string-db.org/network/268739.Nmlp_1208 | LctP family transport protein. |
| Nmlp_1209 protein network | https://string-db.org/network/268739.Nmlp_1209 | UCP012666 family protein. |
| tfbA4 protein network | https://string-db.org/network/268739.Nmlp_1210 | Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB). |
| ilvA protein network | https://string-db.org/network/268739.Nmlp_1211 | Threonine ammonia-lyase. |
| NosY3 protein network | https://string-db.org/network/268739.Nmlp_1212 | ABC-type transport system permease protein. |
| NosF3 protein network | https://string-db.org/network/268739.Nmlp_1213 | ABC-type transport system ATP-binding protein. |
| pcn protein network | https://string-db.org/network/268739.Nmlp_1214 | DNA polymerase sliding clamp; Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA [...] |
| dsa protein network | https://string-db.org/network/268739.Nmlp_1215 | Dihydrolipoamide S-acyltransferase. |
| oxdhB protein network | https://string-db.org/network/268739.Nmlp_1216 | 2-oxo-3-methylvalerate dehydrogenase E1 component beta subunit. |
| oxdhA1 protein network | https://string-db.org/network/268739.Nmlp_1217 | 2-oxo-3-methylvalerate dehydrogenase E1 component alpha subunit. |
| Nmlp_1218 protein network | https://string-db.org/network/268739.Nmlp_1218 | Uncharacterized protein. |
| priL protein network | https://string-db.org/network/268739.Nmlp_1219 | DNA primase large subunit; Regulatory subunit of DNA primase, an RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. Stab [...] |
| Nmlp_1220 protein network | https://string-db.org/network/268739.Nmlp_1220 | Uncharacterized protein. |
| carS protein network | https://string-db.org/network/268739.Nmlp_1221 | CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol synthase; Catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn- glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1- phosphate [...] |
| Nmlp_1222 protein network | https://string-db.org/network/268739.Nmlp_1222 | DUF502 family protein. |
| ubiA1 protein network | https://string-db.org/network/268739.Nmlp_1223 | UbiA family prenyltransferase. |
| Nmlp_1224 protein network | https://string-db.org/network/268739.Nmlp_1224 | TRAM domain protein. |
| tfx protein network | https://string-db.org/network/268739.Nmlp_1225 | Tfx-type DNA-binding protein. |
| Nmlp_1226 protein network | https://string-db.org/network/268739.Nmlp_1226 | Probable oxidoreductase (short-chain dehydrogenase family). |
| Nmlp_1227 protein network | https://string-db.org/network/268739.Nmlp_1227 | Uncharacterized protein. |
| rpa3 protein network | https://string-db.org/network/268739.Nmlp_1228 | Replication protein A. |
| rpap3 protein network | https://string-db.org/network/268739.Nmlp_1229 | Rpa-associated protein. |
| pibD protein network | https://string-db.org/network/268739.Nmlp_1230 | Prepilin/preflagellin peptidase. |
| Nmlp_1231 protein network | https://string-db.org/network/268739.Nmlp_1231 | Uncharacterized protein. |
| guaAa1 protein network | https://string-db.org/network/268739.Nmlp_1232 | GMP synthase (glutamine-hydrolyzing) subunit A; Catalyzes the synthesis of GMP from XMP. |
| Nmlp_1233 protein network | https://string-db.org/network/268739.Nmlp_1233 | Uncharacterized protein. |
| leuA2 protein network | https://string-db.org/network/268739.Nmlp_1234 | 2-isopropylmalate synthase / (R)-citramalate synthase; Belongs to the alpha-IPM synthase/homocitrate synthase family. |
| Nmlp_1235 protein network | https://string-db.org/network/268739.Nmlp_1235 | DUF192 family protein. |
| secG protein network | https://string-db.org/network/268739.Nmlp_1236 | Protein translocase subunit SecG; Involved in protein export. The function of the beta subunit is unknown, but it may be involved in stabilization of the trimeric complex. |
| trxA1 protein network | https://string-db.org/network/268739.Nmlp_1237 | Thioredoxin. |
| argF protein network | https://string-db.org/network/268739.Nmlp_1238 | Ornithine carbamoyltransferase. |
| argE protein network | https://string-db.org/network/268739.Nmlp_1239 | Acetylornithine deacetylase; Catalyzes the release of L-lysine from [LysW]-gamma-L-lysine and the release of L-ornithine from [LysW]-L-ornithine. |
| argD protein network | https://string-db.org/network/268739.Nmlp_1240 | Acetylornithine aminotransferase; Involved in both the arginine and lysine biosynthetic pathways; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. LysJ subfamily. |
| argB protein network | https://string-db.org/network/268739.Nmlp_1241 | Acetylglutamate kinase; Involved in both the arginine and lysine biosynthetic pathways. Phosphorylates the LysW-bound precursors glutamate (for arginine biosynthesis), respectively alpha-aminoadi [...] |
| argC protein network | https://string-db.org/network/268739.Nmlp_1242 | N-acetyl-gamma-glutamyl-phosphate reductase; Involved in both the arginine and lysine biosynthetic pathways; Belongs to the NAGSA dehydrogenase family. Type 1 subfamily. LysY sub-subfamily. |
| argX protein network | https://string-db.org/network/268739.Nmlp_1243 | Probable glutamate--argW ligase. |
| argW protein network | https://string-db.org/network/268739.Nmlp_1244 | Probable biosynthetic carrier protein ArgW. |
| argH protein network | https://string-db.org/network/268739.Nmlp_1245 | Argininosuccinate lyase. |
| argG protein network | https://string-db.org/network/268739.Nmlp_1246 | Argininosuccinate synthase; Belongs to the argininosuccinate synthase family. Type 1 subfamily. |
| Nmlp_1247 protein network | https://string-db.org/network/268739.Nmlp_1247 | DUF456 family protein. |
| Nmlp_1248 protein network | https://string-db.org/network/268739.Nmlp_1248 | PsiE domain protein. |
| Nmlp_1249 protein network | https://string-db.org/network/268739.Nmlp_1249 | Probable secreted glycoprotein. |
| Nmlp_1250 protein network | https://string-db.org/network/268739.Nmlp_1250 | Uncharacterized protein. |
| Nmlp_1251 protein network | https://string-db.org/network/268739.Nmlp_1251 | Phosphodiesterase domain protein. |
| Nmlp_1252 protein network | https://string-db.org/network/268739.Nmlp_1252 | Uncharacterized protein. |
| Nmlp_1253 protein network | https://string-db.org/network/268739.Nmlp_1253 | FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase). |
| hisE protein network | https://string-db.org/network/268739.Nmlp_1254 | phosphoribosyl-ATP pyrophosphatase. |
| Nmlp_1255 protein network | https://string-db.org/network/268739.Nmlp_1255 | DUF151 family protein. |
| pdxT protein network | https://string-db.org/network/268739.Nmlp_1256 | Pyridoxal 5'-phosphate synthase subunit PdxT; Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5'-phosphate. The resulting ammonia molecule [...] |
| Nmlp_1257 protein network | https://string-db.org/network/268739.Nmlp_1257 | MJ0936 family phosphodiesterase. |
| Nmlp_1258 protein network | https://string-db.org/network/268739.Nmlp_1258 | ArsR family transcription regulator. |
| Nmlp_1259 protein network | https://string-db.org/network/268739.Nmlp_1259 | Uncharacterized protein. |
| leuS protein network | https://string-db.org/network/268739.Nmlp_1260 | leucine--tRNA ligase; Belongs to the class-I aminoacyl-tRNA synthetase family. |
| Nmlp_1261 protein network | https://string-db.org/network/268739.Nmlp_1261 | Uncharacterized protein. |
| uvrC protein network | https://string-db.org/network/268739.Nmlp_1262 | UvrABC system protein C; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsible [...] |
| Nmlp_1271 protein network | https://string-db.org/network/268739.Nmlp_1271 | Uncharacterized protein. |
| Nmlp_1272 protein network | https://string-db.org/network/268739.Nmlp_1272 | Uncharacterized protein. |
| Nmlp_1273 protein network | https://string-db.org/network/268739.Nmlp_1273 | Uncharacterized protein. |
| Nmlp_1274 protein network | https://string-db.org/network/268739.Nmlp_1274 | Uncharacterized protein. |
| tbp4 protein network | https://string-db.org/network/268739.Nmlp_1275 | TATA-binding transcription initiation factor. |
| Nmlp_1276 protein network | https://string-db.org/network/268739.Nmlp_1276 | Probable restriction/modification enzyme. |
| Nmlp_1277 protein network | https://string-db.org/network/268739.Nmlp_1277 | Probable DEAD/DEAH box helicase. |
| Nmlp_1278 protein network | https://string-db.org/network/268739.Nmlp_1278 | Small CPxCG-related zinc finger protein. |
| Nmlp_1280 protein network | https://string-db.org/network/268739.Nmlp_1280 | Uncharacterized protein. |
| Nmlp_1281 protein network | https://string-db.org/network/268739.Nmlp_1281 | Uncharacterized protein. |
| Nmlp_1282 protein network | https://string-db.org/network/268739.Nmlp_1282 | Uncharacterized protein. |
| Nmlp_1285 protein network | https://string-db.org/network/268739.Nmlp_1285 | IS1341-type transposase ISNamo19. |
| Nmlp_1286 protein network | https://string-db.org/network/268739.Nmlp_1286 | IS200-type transposase ISNamo19. |
| Nmlp_1287 protein network | https://string-db.org/network/268739.Nmlp_1287 | DUF151 family protein. |
| Nmlp_1288 protein network | https://string-db.org/network/268739.Nmlp_1288 | Uncharacterized protein. |
| Nmlp_1289 protein network | https://string-db.org/network/268739.Nmlp_1289 | Uncharacterized protein. |
| hop protein network | https://string-db.org/network/268739.Nmlp_1290 | Halorhodopsin. |
| blp protein network | https://string-db.org/network/268739.Nmlp_1291 | Blp-like protein. |
| blh protein network | https://string-db.org/network/268739.Nmlp_1292 | Beta-carotene 15,15'-dioxygenase Blh; Catalyzes the cleavage of beta-carotene at its central double bond (15,15') to yield two molecules of all-trans-retinal. Belongs to the Brp/Blh beta-carotene [...] |
| crtY protein network | https://string-db.org/network/268739.Nmlp_1293 | Lycopene beta-cyclase. |
| bat protein network | https://string-db.org/network/268739.Nmlp_1294 | HTH-type transcriptional regulator, bacterioopsin transcriptional activator and related proteins; Receiver/sensor/bat box HTH-10 family transcription regulator Bat (homolog to bacterioopsin activ [...] |
| Nmlp_1295 protein network | https://string-db.org/network/268739.Nmlp_1295 | UspA domain protein. |
| cre1 protein network | https://string-db.org/network/268739.Nmlp_1296 | Creatininase domain protein. |
| rpl16 protein network | https://string-db.org/network/268739.Nmlp_1297 | 50S ribosomal protein L16; Belongs to the universal ribosomal protein uL16 family. |
| ths2 protein network | https://string-db.org/network/268739.Nmlp_1298 | Thermosome subunit 2; Belongs to the TCP-1 chaperonin family. |
| Nmlp_1299 protein network | https://string-db.org/network/268739.Nmlp_1299 | Uncharacterized protein. |
| Nmlp_1300 protein network | https://string-db.org/network/268739.Nmlp_1300 | Uncharacterized protein. |
| Nmlp_1301 protein network | https://string-db.org/network/268739.Nmlp_1301 | Probable carbon-nitrogen hydrolase. |
| Nmlp_1302 protein network | https://string-db.org/network/268739.Nmlp_1302 | START domain protein. |
| Nmlp_1303 protein network | https://string-db.org/network/268739.Nmlp_1303 | HTH domain protein. |
| Nmlp_1304 protein network | https://string-db.org/network/268739.Nmlp_1304 | Uncharacterized protein. |
| Nmlp_1305 protein network | https://string-db.org/network/268739.Nmlp_1305 | Small CPxCG-related zinc finger protein. |
| Nmlp_1306 protein network | https://string-db.org/network/268739.Nmlp_1306 | DUF457 family protein. |
| atpD protein network | https://string-db.org/network/268739.Nmlp_1307 | A-type ATP synthase subunit D; Produces ATP from ADP in the presence of a proton gradient across the membrane. |
| atpB protein network | https://string-db.org/network/268739.Nmlp_1308 | A-type ATP synthase subunit B; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal beta chain is a regulatory subunit. |
| atpA protein network | https://string-db.org/network/268739.Nmlp_1309 | A-type ATP synthase subunit A; Produces ATP from ADP in the presence of a proton gradient across the membrane. The archaeal alpha chain is a catalytic subunit. Belongs to the ATPase alpha/beta ch [...] |
| atpF protein network | https://string-db.org/network/268739.Nmlp_1310 | A-type ATP synthase subunit F; Produces ATP from ADP in the presence of a proton gradient across the membrane. |
| atpC protein network | https://string-db.org/network/268739.Nmlp_1311 | A-type ATP synthase subunit C; Produces ATP from ADP in the presence of a proton gradient across the membrane. |
| atpE protein network | https://string-db.org/network/268739.Nmlp_1312 | A-type ATP synthase subunit E; Produces ATP from ADP in the presence of a proton gradient across the membrane. |
| atpK protein network | https://string-db.org/network/268739.Nmlp_1313 | A-type ATP synthase subunit K. |
| atpI protein network | https://string-db.org/network/268739.Nmlp_1315 | A-type ATP synthase subunit I; Belongs to the V-ATPase 116 kDa subunit family. |
| atpH protein network | https://string-db.org/network/268739.Nmlp_1316 | A-type ATP synthase subunit H. |
| tif6 protein network | https://string-db.org/network/268739.Nmlp_1317 | Translation initiation factor aIF-6; Binds to the 50S ribosomal subunit and prevents its association with the 30S ribosomal subunit to form the 70S initiation complex. |
| rpl31e protein network | https://string-db.org/network/268739.Nmlp_1318 | 50S ribosomal protein L31e; Belongs to the ribosomal protein L31e family. |
| rpl39e protein network | https://string-db.org/network/268739.Nmlp_1319 | 50S ribosomal protein L39e; Belongs to the eukaryotic ribosomal protein eL39 family. |
| Nmlp_1320 protein network | https://string-db.org/network/268739.Nmlp_1320 | TrmB family transcription regulator. |
| Nmlp_1321 protein network | https://string-db.org/network/268739.Nmlp_1321 | Oxidoreductase (homolog to thioredoxin-disulfide reductase). |
| Act protein network | https://string-db.org/network/268739.Nmlp_1322 | Thioesterase domain protein. |
| tatC2 protein network | https://string-db.org/network/268739.Nmlp_1323 | Sec-independent protein translocase subunit TatC; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...] |
| tatC1 protein network | https://string-db.org/network/268739.Nmlp_1324 | Sec-independent protein translocase subunit TatC; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...] |
| Nmlp_1325 protein network | https://string-db.org/network/268739.Nmlp_1325 | Homolog to S-adenosylmethionine-dependent methyltransferase. |
| gth4 protein network | https://string-db.org/network/268739.Nmlp_1326 | Probable glycosyltransferase, type 1. |
| Nmlp_1327 protein network | https://string-db.org/network/268739.Nmlp_1327 | PtpS family protein. |
| Nmlp_1328 protein network | https://string-db.org/network/268739.Nmlp_1328 | Oxidoreductase (homolog to zinc-containing alcohol dehydrogenase / threonine 3-dehydrogenase). |
| Nmlp_1329 protein network | https://string-db.org/network/268739.Nmlp_1329 | AlkP-core domain protein. |
| Nmlp_1330 protein network | https://string-db.org/network/268739.Nmlp_1330 | Probable oxidoreductase (aldo-keto reductase family protein). |
| Nmlp_1331 protein network | https://string-db.org/network/268739.Nmlp_1331 | Uncharacterized protein. |
| pgsA1 protein network | https://string-db.org/network/268739.Nmlp_1332 | CDP-alcohol 1-archaetidyltransferase; Belongs to the CDP-alcohol phosphatidyltransferase class-I family. |
| Nmlp_1333 protein network | https://string-db.org/network/268739.Nmlp_1333 | DUF457 family protein. |
| purC protein network | https://string-db.org/network/268739.Nmlp_1334 | Phosphoribosylaminoimidazole-succinocarboxamide synthase; Belongs to the SAICAR synthetase family. |
| Nmlp_1335 protein network | https://string-db.org/network/268739.Nmlp_1335 | Uncharacterized protein; Product: IS200-type transposase NmIRS32 (nonfunctional). |
| Nmlp_1336 protein network | https://string-db.org/network/268739.Nmlp_1336 | PHP domain protein. |
| Nmlp_1337 protein network | https://string-db.org/network/268739.Nmlp_1337 | Uncharacterized protein. |
| phaB protein network | https://string-db.org/network/268739.Nmlp_1338 | 3-oxoacyl-CoA reductase (NADP). |
| Nmlp_1339 protein network | https://string-db.org/network/268739.Nmlp_1339 | Histidine kinase. |
| Nmlp_1340 protein network | https://string-db.org/network/268739.Nmlp_1340 | Uncharacterized protein. |
| nosD3 protein network | https://string-db.org/network/268739.Nmlp_1341 | ABC-type transport system periplasmic substrate-binding protein (probable substrate copper). |
| mtfK2 protein network | https://string-db.org/network/268739.Nmlp_1342 | FKBP-type peptidylprolyl isomerase. |
| CyaB protein network | https://string-db.org/network/268739.Nmlp_1343 | Adenylate cyclase domain protein. |
| mat protein network | https://string-db.org/network/268739.Nmlp_1344 | S-adenosylmethionine synthase; Catalyzes the formation of S-adenosylmethionine from methionine and ATP; Belongs to the AdoMet synthase 2 family. |
| Nmlp_1345 protein network | https://string-db.org/network/268739.Nmlp_1345 | Uncharacterized protein. |
| Nmlp_1346 protein network | https://string-db.org/network/268739.Nmlp_1346 | Uncharacterized protein. |
| pilB1 protein network | https://string-db.org/network/268739.Nmlp_1347 | Type IV pilus biogenesis complex ATPase subunit. |
| pilC1 protein network | https://string-db.org/network/268739.Nmlp_1348 | Type IV pilus biogenesis complex membrane subunit. |
| Nmlp_1349 protein network | https://string-db.org/network/268739.Nmlp_1349 | Probable S-adenosylmethionine-dependent methyltransferase. |
| Nmlp_1350 protein network | https://string-db.org/network/268739.Nmlp_1350 | DoxX domain protein. |
| Nmlp_1351 protein network | https://string-db.org/network/268739.Nmlp_1351 | DUF1405 family protein. |
| pdxS protein network | https://string-db.org/network/268739.Nmlp_1352 | Pyridoxal 5'-phosphate synthase subunit PdxS; Catalyzes the formation of pyridoxal 5'-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia. The ammonia is provide [...] |
| Nmlp_1353 protein network | https://string-db.org/network/268739.Nmlp_1353 | DUF373 family protein. |
| nreA protein network | https://string-db.org/network/268739.Nmlp_1354 | DNA repair protein NreA; Involved in DNA damage repair. |
| rnhA2 protein network | https://string-db.org/network/268739.Nmlp_1355 | Ribonuclease H, type 1. |
| Nmlp_1356 protein network | https://string-db.org/network/268739.Nmlp_1356 | Uncharacterized protein. |
| ipp1 protein network | https://string-db.org/network/268739.Nmlp_1357 | Inorganic pyrophosphatase; Catalyzes the hydrolysis of inorganic pyrophosphate (PPi) forming two phosphate ions. |
| pilC2 protein network | https://string-db.org/network/268739.Nmlp_1358 | Type IV pilus biogenesis complex membrane subunit. |
| pilB2 protein network | https://string-db.org/network/268739.Nmlp_1359 | Type IV pilus biogenesis complex ATPase subunit. |
| Nmlp_1360 protein network | https://string-db.org/network/268739.Nmlp_1360 | Probable amidase. |
| Nmlp_1361 protein network | https://string-db.org/network/268739.Nmlp_1361 | UspA domain protein. |
| Nmlp_1362 protein network | https://string-db.org/network/268739.Nmlp_1362 | UspA domain protein. |
| jamm1 protein network | https://string-db.org/network/268739.Nmlp_1363 | Metalloprotease JAMM1, desampylating. |
| Nmlp_1364 protein network | https://string-db.org/network/268739.Nmlp_1364 | ABC-type transport system periplasmic substrate-binding protein (probable substrate iron/cobalamin). |
| argS protein network | https://string-db.org/network/268739.Nmlp_1365 | arginine--tRNA ligase; Belongs to the class-I aminoacyl-tRNA synthetase family. |
| taw1 protein network | https://string-db.org/network/268739.Nmlp_1366 | tRNA-(4-demethylwyosine) synthase, S-adenosyl-L-methionine-dependent; Component of the wyosine derivatives biosynthesis pathway that catalyzes the condensation of N-methylguanine with 2 carbon at [...] |
| ribK protein network | https://string-db.org/network/268739.Nmlp_1367 | Riboflavin kinase, CTP-dependent; Catalyzes the CTP-dependent phosphorylation of riboflavin (vitamin B2) to form flavin mononucleotide (FMN); Belongs to the archaeal riboflavin kinase family. |
| ribB protein network | https://string-db.org/network/268739.Nmlp_1368 | 3,4-dihydroxy-2-butanone 4-phosphate synthase; Catalyzes the conversion of D-ribulose 5-phosphate to formate and 3,4-dihydroxy-2-butanone 4-phosphate. |
| rpa2 protein network | https://string-db.org/network/268739.Nmlp_1371 | Replication protein A. |
| hstA protein network | https://string-db.org/network/268739.Nmlp_1372 | Archaeal histone. |
| hda1 protein network | https://string-db.org/network/268739.Nmlp_1373 | HdaI-type histone deacetylase. |
| cca protein network | https://string-db.org/network/268739.Nmlp_1374 | tRNA adenylyltransferase, CCA-adding; Catalyzes the addition and repair of the essential 3'- terminal CCA sequence in tRNAs without using a nucleic acid template. Adds these three nucleotides in [...] |
| cbs2 protein network | https://string-db.org/network/268739.Nmlp_1377 | CBS domain protein. |
| glyS protein network | https://string-db.org/network/268739.Nmlp_1378 | glycine--tRNA ligase. |
| hef protein network | https://string-db.org/network/268739.Nmlp_1380 | ATP-dependent RNA helicase/nuclease Hef; Product: Kef-type transport system (probable substrate potassium) (nonfunctional). |
| Nmlp_1381 protein network | https://string-db.org/network/268739.Nmlp_1381 | UPF0148 family protein. |
| Nmlp_1382 protein network | https://string-db.org/network/268739.Nmlp_1382 | PUA domain protein. |
| sepF protein network | https://string-db.org/network/268739.Nmlp_1383 | Probable SepF protein. |
| Nmlp_1384 protein network | https://string-db.org/network/268739.Nmlp_1384 | DUF124 family protein. |
| Nmlp_1385 protein network | https://string-db.org/network/268739.Nmlp_1385 | MOSC domain protein. |
| Nmlp_1386 protein network | https://string-db.org/network/268739.Nmlp_1386 | Uncharacterized protein. |
| Nmlp_1387 protein network | https://string-db.org/network/268739.Nmlp_1387 | KaiC domain protein. |
| glpK2 protein network | https://string-db.org/network/268739.Nmlp_1388 | Glycerol kinase; Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn- glycerol 3-phosphate. |
| kdgK protein network | https://string-db.org/network/268739.Nmlp_1389 | 2-keto-3-deoxygluconate kinase; Belongs to the carbohydrate kinase PfkB family. |
| gnaD protein network | https://string-db.org/network/268739.Nmlp_1390 | D-gluconate dehydratase. |
| Nmlp_1391 protein network | https://string-db.org/network/268739.Nmlp_1391 | Uncharacterized protein. |
| kdgA protein network | https://string-db.org/network/268739.Nmlp_1392 | 2-dehydro-3-deoxy-(phospho)gluconate aldolase,archaeal-type. |
| Nmlp_1393 protein network | https://string-db.org/network/268739.Nmlp_1393 | HAD superfamily hydrolase. |
| gdh protein network | https://string-db.org/network/268739.Nmlp_1394 | Glucose 1-dehydrogenase; Catalyzes the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate via gluconolactone. Can utilize both NAD(+) and NADP(+) as electron acceptor. Is involved in the d [...] |
| trmB protein network | https://string-db.org/network/268739.Nmlp_1395 | TrmB family transcription regulator TrmB. |
| aldH2 protein network | https://string-db.org/network/268739.Nmlp_1397 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| pykA protein network | https://string-db.org/network/268739.Nmlp_1398 | Pyruvate kinase; Belongs to the pyruvate kinase family. |
| mgsA protein network | https://string-db.org/network/268739.Nmlp_1399 | Methylglyoxal synthase; Catalyzes the formation of methylglyoxal from dihydroxyacetone phosphate. |
| Nmlp_1402 protein network | https://string-db.org/network/268739.Nmlp_1402 | HAD superfamily hydrolase. |
| Nmlp_1403 protein network | https://string-db.org/network/268739.Nmlp_1403 | Uncharacterized protein. |
| Nmlp_1404 protein network | https://string-db.org/network/268739.Nmlp_1404 | Uncharacterized protein. |
| bdbC protein network | https://string-db.org/network/268739.Nmlp_1405 | Disulfide bond formation protein. |
| Nmlp_1406 protein network | https://string-db.org/network/268739.Nmlp_1406 | Sensor box protein. |
| Nmlp_1407 protein network | https://string-db.org/network/268739.Nmlp_1407 | Uncharacterized protein. |
| Nmlp_1408 protein network | https://string-db.org/network/268739.Nmlp_1408 | Uncharacterized protein. |
| Nmlp_1409 protein network | https://string-db.org/network/268739.Nmlp_1409 | Sensor box histidine kinase. |
| hadL protein network | https://string-db.org/network/268739.Nmlp_1410 | Haloacid dehalogenase, type II. |
| thpR protein network | https://string-db.org/network/268739.Nmlp_1411 | RNA 2',3'-cyclic phosphodiesterase; Hydrolyzes RNA 2',3'-cyclic phosphodiester to an RNA 2'- phosphomonoester; Belongs to the 2H phosphoesterase superfamily. ThpR family. |
| gndA protein network | https://string-db.org/network/268739.Nmlp_1412 | 6-phosphogluconate dehydrogenase (NAD-dependent, decarboxylating); Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of N [...] |
| Nmlp_1413 protein network | https://string-db.org/network/268739.Nmlp_1413 | Uncharacterized protein. |
| metY1 protein network | https://string-db.org/network/268739.Nmlp_1414 | O-acetylhomoserine aminocarboxypropyltransferase (methionine synthase). |
| metX protein network | https://string-db.org/network/268739.Nmlp_1415 | Homoserine O-acetyltransferase; Transfers an acetyl group from acetyl-CoA to L-homoserine, forming acetyl-L-homoserine. |
| Nmlp_1416 protein network | https://string-db.org/network/268739.Nmlp_1416 | PQQ repeat protein. |
| metY2 protein network | https://string-db.org/network/268739.Nmlp_1417 | O-acetylhomoserine aminocarboxypropyltransferase (methionine synthase). |
| serB protein network | https://string-db.org/network/268739.Nmlp_1420 | Phosphoserine phosphatase; This gene seems complete but lacks its stop codon so that the reading frame continues into an adjacent ISH element; locus_tag: Nmlp_1419; product: UspA domain protein ( [...] |
| serA1 protein network | https://string-db.org/network/268739.Nmlp_1421 | D-3-phosphoglycerate dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. |
| arf1 protein network | https://string-db.org/network/268739.Nmlp_1422 | Peptide chain release factor aRF-1; Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. |
| Nmlp_1423 protein network | https://string-db.org/network/268739.Nmlp_1423 | DUF373 family protein. |
| dph6 protein network | https://string-db.org/network/268739.Nmlp_1424 | Diphthamide biosynthesis protein Dph6. |
| graD protein network | https://string-db.org/network/268739.Nmlp_1425 | Sugar nucleotidyltransferase. |
| Nmlp_1426 protein network | https://string-db.org/network/268739.Nmlp_1426 | HTH domain protein. |
| Nmlp_1427 protein network | https://string-db.org/network/268739.Nmlp_1427 | AAA-type ATPase (MoxR subfamily). |
| Nmlp_1428 protein network | https://string-db.org/network/268739.Nmlp_1428 | Uncharacterized protein. |
| Nmlp_1429 protein network | https://string-db.org/network/268739.Nmlp_1429 | endoisopeptidase/DUF4129 domain protein. |
| tif1 protein network | https://string-db.org/network/268739.Nmlp_1430 | Translation initiation factor aIF-1 (SUI1 protein, bacterial-type IF3); Belongs to the SUI1 family. |
| Nmlp_1431 protein network | https://string-db.org/network/268739.Nmlp_1431 | Rhodanese domain protein. |
| Nmlp_1432 protein network | https://string-db.org/network/268739.Nmlp_1432 | DUF1628 domain protein. |
| Nmlp_1433 protein network | https://string-db.org/network/268739.Nmlp_1433 | NUDIX family hydrolase. |
| Nmlp_1434 protein network | https://string-db.org/network/268739.Nmlp_1434 | Uncharacterized protein. |
| Nmlp_1435 protein network | https://string-db.org/network/268739.Nmlp_1435 | Uncharacterized protein. |
| Nmlp_1436 protein network | https://string-db.org/network/268739.Nmlp_1436 | GNAT family acetyltransferase. |
| Nmlp_1437 protein network | https://string-db.org/network/268739.Nmlp_1437 | ISH14-type transposase ISNamo12. |
| Nmlp_1438 protein network | https://string-db.org/network/268739.Nmlp_1438 | IS1341-type transposase ISNamo22; Product: nitroreductase family protein (nonfunctional); part of the region does not belong to this CDS as coordinates speficy only the outer boundaries; gene has [...] |
| Nmlp_1439 protein network | https://string-db.org/network/268739.Nmlp_1439 | Uncharacterized protein. |
| nitB protein network | https://string-db.org/network/268739.Nmlp_1441 | Nitrilase. |
| Nmlp_1442 protein network | https://string-db.org/network/268739.Nmlp_1442 | DICT domain protein. |
| ftsY protein network | https://string-db.org/network/268739.Nmlp_1443 | Signal recognition particle receptor FtsY; Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Acts as a receptor for the complex formed by the signal [...] |
| pfdA protein network | https://string-db.org/network/268739.Nmlp_1444 | Prefoldin alpha subunit; Molecular chaperone capable of stabilizing a range of proteins. Seems to fulfill an ATP-independent, HSP70-like function in archaeal de novo protein folding. |
| rpl20e protein network | https://string-db.org/network/268739.Nmlp_1445 | 50S ribosomal protein L20e. |
| Nmlp_1446 protein network | https://string-db.org/network/268739.Nmlp_1446 | Probable PAP2-type phosphatase. |
| Nmlp_1447 protein network | https://string-db.org/network/268739.Nmlp_1447 | UPF0761 family protein. |
| Nmlp_1448 protein network | https://string-db.org/network/268739.Nmlp_1448 | Pantoate kinase. |
| mrpE protein network | https://string-db.org/network/268739.Nmlp_1450 | Mrp-type sodium/proton antiporter system subunit E. |
| mrpF protein network | https://string-db.org/network/268739.Nmlp_1451 | Mrp-type sodium/proton antiporter system subunit F. |
| mrpG protein network | https://string-db.org/network/268739.Nmlp_1452 | Mrp-type sodium/proton antiporter system subunit G. |
| mrpB1 protein network | https://string-db.org/network/268739.Nmlp_1453 | Mrp-type sodium/proton antiporter system subunit B1. |
| mrpB2 protein network | https://string-db.org/network/268739.Nmlp_1454 | Mrp-type sodium/proton antiporter system subunit B2. |
| mrpC protein network | https://string-db.org/network/268739.Nmlp_1455 | Mrp-type sodium/proton antiporter system subunit C. |
| mrpD3 protein network | https://string-db.org/network/268739.Nmlp_1456 | Mrp-type sodium/proton antiporter system subunit D3. |
| mrpD1 protein network | https://string-db.org/network/268739.Nmlp_1457 | Mrp-type sodium/proton antiporter system subunit D1. |
| mrpD2 protein network | https://string-db.org/network/268739.Nmlp_1458 | Mrp-type sodium/proton antiporter system subunit D2. |
| Nmlp_1460 protein network | https://string-db.org/network/268739.Nmlp_1460 | Small CPxCG-related zinc finger protein; Gene is interrupted (frameshift,in-frame stop); locus_tag: Nmlp_1459; product: ISH14-type transposase NmIRS15 (nonfunctional); conceptual translation afte [...] |
| ashA protein network | https://string-db.org/network/268739.Nmlp_1461 | Archaea-specific helicase AshA. |
| Nmlp_1463 protein network | https://string-db.org/network/268739.Nmlp_1463 | HTH domain protein. |
| purA protein network | https://string-db.org/network/268739.Nmlp_1465 | Adenylosuccinate synthase; Plays an important role in the de novo pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP; Belongs to the [...] |
| htr28 protein network | https://string-db.org/network/268739.Nmlp_1466 | Transducer protein Htr28. |
| idiA protein network | https://string-db.org/network/268739.Nmlp_1467 | Isopentenyl-diphosphate delta-isomerase, type I. |
| Nmlp_1468 protein network | https://string-db.org/network/268739.Nmlp_1468 | Uncharacterized protein. |
| Nmlp_1469 protein network | https://string-db.org/network/268739.Nmlp_1469 | PrpD family protein. |
| Nmlp_1470 protein network | https://string-db.org/network/268739.Nmlp_1470 | Uncharacterized protein. |
| qor1 protein network | https://string-db.org/network/268739.Nmlp_1471 | NADPH:quinone reductase. |
| moaB1 protein network | https://string-db.org/network/268739.Nmlp_1472 | Molybdopterin adenylyltransferase. |
| Nmlp_1473 protein network | https://string-db.org/network/268739.Nmlp_1473 | Cupin 2 barrel domain protein. |
| Nmlp_1474 protein network | https://string-db.org/network/268739.Nmlp_1474 | Uncharacterized protein. |
| cspA1 protein network | https://string-db.org/network/268739.Nmlp_1475 | Cold shock protein. |
| cynT protein network | https://string-db.org/network/268739.Nmlp_1476 | Carbonic anhydrase. |
| Nmlp_1477 protein network | https://string-db.org/network/268739.Nmlp_1477 | Uncharacterized protein. |
| Nmlp_1478 protein network | https://string-db.org/network/268739.Nmlp_1478 | YqjG-type gamma-glutamylcysteinyl-hydroquinone reductase. |
| dppF protein network | https://string-db.org/network/268739.Nmlp_1479 | ABC-type transport system ATP-binding protein (probable substrate dipeptide/oligopeptide). |
| dppD protein network | https://string-db.org/network/268739.Nmlp_1480 | ABC-type transport system ATP-binding protein (probable substrate dipeptide/oligopeptide). |
| dppC protein network | https://string-db.org/network/268739.Nmlp_1481 | ABC-type transport system permease protein (probable substrate dipeptide/oligopeptide). |
| dppB protein network | https://string-db.org/network/268739.Nmlp_1482 | ABC-type transport system permease protein (probable substrate dipeptide/oligopeptide). |
| dppA protein network | https://string-db.org/network/268739.Nmlp_1483 | ABC-type transport system periplasmic substrate-binding protein (probable substrate dipeptide/oligopeptide). |
| Nmlp_1484 protein network | https://string-db.org/network/268739.Nmlp_1484 | 2-haloacid dehalogenase family protein. |
| Nmlp_1485 protein network | https://string-db.org/network/268739.Nmlp_1485 | Uncharacterized protein. |
| Nmlp_1486 protein network | https://string-db.org/network/268739.Nmlp_1486 | Probable S-adenosylmethionine-dependent methyltransferase. |
| speB1 protein network | https://string-db.org/network/268739.Nmlp_1487 | Agmatinase; Belongs to the arginase family. |
| Nmlp_1488 protein network | https://string-db.org/network/268739.Nmlp_1488 | ArsR family transcription regulator. |
| Nmlp_1489 protein network | https://string-db.org/network/268739.Nmlp_1489 | Uncharacterized protein. |
| Nmlp_1490 protein network | https://string-db.org/network/268739.Nmlp_1490 | Uncharacterized protein. |
| Nmlp_1491 protein network | https://string-db.org/network/268739.Nmlp_1491 | Uncharacterized protein. |
| Nmlp_1492 protein network | https://string-db.org/network/268739.Nmlp_1492 | ArsR family transcription regulator. |
| Nmlp_1493 protein network | https://string-db.org/network/268739.Nmlp_1493 | Uncharacterized protein. |
| Nmlp_1494 protein network | https://string-db.org/network/268739.Nmlp_1494 | DUF162 family protein. |
| Nmlp_1495 protein network | https://string-db.org/network/268739.Nmlp_1495 | Probable iron-sulfur protein (4Fe-4S). |
| Nmlp_1496 protein network | https://string-db.org/network/268739.Nmlp_1496 | GNAT family acetyltransferase. |
| msrA2 protein network | https://string-db.org/network/268739.Nmlp_1497 | Peptide methionine sulfoxide reductase MsrA (S-form specific). |
| pimT2 protein network | https://string-db.org/network/268739.Nmlp_1498 | protein-L-isoaspartate O-methyltransferase. |
| pimT1 protein network | https://string-db.org/network/268739.Nmlp_1499 | protein-L-isoaspartate O-methyltransferase; Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl [...] |
| Nmlp_1500 protein network | https://string-db.org/network/268739.Nmlp_1500 | UCP015877 family protein. |
| pepB1 protein network | https://string-db.org/network/268739.Nmlp_1501 | Aminopeptidase (homolog to leucyl aminopeptidase. |
| gap protein network | https://string-db.org/network/268739.Nmlp_1502 | Glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) (phosphorylating). |
| pchA2 protein network | https://string-db.org/network/268739.Nmlp_1503 | Ion channel pore / TrkA domain protein. |
| hsp20A protein network | https://string-db.org/network/268739.Nmlp_1504 | Hsp20-type molecular chaperone; Belongs to the small heat shock protein (HSP20) family. |
| Nmlp_1505 protein network | https://string-db.org/network/268739.Nmlp_1505 | Transport protein (probable substrate arsenite). |
| Nmlp_1506 protein network | https://string-db.org/network/268739.Nmlp_1506 | ArsR family transcription regulator. |
| Nmlp_1507 protein network | https://string-db.org/network/268739.Nmlp_1507 | P-type transport ATPase (probable substrate calcium/metal cation). |
| Nmlp_1509 protein network | https://string-db.org/network/268739.Nmlp_1509 | Uncharacterized protein. |
| Nmlp_1510 protein network | https://string-db.org/network/268739.Nmlp_1510 | IS1341-type transposase ISNamo18. |
| CCT61390.1 protein network | https://string-db.org/network/268739.Nmlp_1510A | IS200-type transposase ISNamo18. |
| Nmlp_1511 protein network | https://string-db.org/network/268739.Nmlp_1511 | Adenine-specific DNA modification methylase. |
| Nmlp_1512 protein network | https://string-db.org/network/268739.Nmlp_1512 | ISH14-type transposase ISNamo10. |
| Nmlp_1513 protein network | https://string-db.org/network/268739.Nmlp_1513 | Uncharacterized protein. |
| Nmlp_1514 protein network | https://string-db.org/network/268739.Nmlp_1514 | HTH domain protein. |
| Nmlp_1515 protein network | https://string-db.org/network/268739.Nmlp_1515 | Probable oxidoreductase (Short-chain dehydrogenase family); Gene is interrupted (frameshift,insert) and is truncated at the N-terminus; product: IS1341-type transposase NmIRS65 (nonfunctional); l [...] |
| Nmlp_1516 protein network | https://string-db.org/network/268739.Nmlp_1516 | Small CPxCG-related zinc finger protein. |
| Nmlp_1517 protein network | https://string-db.org/network/268739.Nmlp_1517 | Major facilitator superfamily transport protein. |
| Nmlp_1518 protein network | https://string-db.org/network/268739.Nmlp_1518 | MJ0936 family phosphodiesterase. |
| Nmlp_1519 protein network | https://string-db.org/network/268739.Nmlp_1519 | Uncharacterized protein. |
| Nmlp_1520 protein network | https://string-db.org/network/268739.Nmlp_1520 | Small CPxCG-related zinc finger protein. |
| ilvD protein network | https://string-db.org/network/268739.Nmlp_1521 | Dihydroxy-acid dehydratase; Belongs to the IlvD/Edd family. |
| Nmlp_1522 protein network | https://string-db.org/network/268739.Nmlp_1522 | Iron-sulfur protein (4Fe-4S). |
| bioN protein network | https://string-db.org/network/268739.Nmlp_1523 | ABC-type transport system permease protein (probable substrate biotin). |
| bioM protein network | https://string-db.org/network/268739.Nmlp_1524 | ABC-type transport system ATP-binding protein (probable substrate biotin). |
| bioY protein network | https://string-db.org/network/268739.Nmlp_1525 | Biotin transport protein BioY. |
| Nmlp_1526 protein network | https://string-db.org/network/268739.Nmlp_1526 | Uncharacterized protein. |
| trxB2 protein network | https://string-db.org/network/268739.Nmlp_1527 | Thioredoxin-disulfide reductase. |
| arsA2 protein network | https://string-db.org/network/268739.Nmlp_1528 | ArsA family ATPase. |
| Nmlp_1529 protein network | https://string-db.org/network/268739.Nmlp_1529 | Oxidoreductase (homolog to thioredoxin-disulfide reductase). |
| phoU5 protein network | https://string-db.org/network/268739.Nmlp_1530 | PhoU domain protein. |
| Nmlp_1531 protein network | https://string-db.org/network/268739.Nmlp_1531 | Uncharacterized protein. |
| rad3a protein network | https://string-db.org/network/268739.Nmlp_1532 | DNA repair helicase Rad3. |
| Nmlp_1533 protein network | https://string-db.org/network/268739.Nmlp_1533 | DUF1684 family protein. |
| Nmlp_1534 protein network | https://string-db.org/network/268739.Nmlp_1534 | AlkP-core domain protein. |
| folA2 protein network | https://string-db.org/network/268739.Nmlp_1535 | Dihydrofolate reductase. |
| Nmlp_1536 protein network | https://string-db.org/network/268739.Nmlp_1536 | Probable S-adenosylmethionine-dependent methyltransferase (homolog to 24-sterol C-methyltransferase). |
| Nmlp_1538 protein network | https://string-db.org/network/268739.Nmlp_1538 | ISHwa16-type transposase ISNamo14; Gene has been targetted by a transposon; locus_tag: Nmlp_1537; product: ISH14-type transposase ISNamo8 (nonfunctional); conceptual translation after in silico r [...] |
| Nmlp_1540 protein network | https://string-db.org/network/268739.Nmlp_1540 | PQQ repeat protein. |
| Nmlp_1541 protein network | https://string-db.org/network/268739.Nmlp_1541 | Small CPxCG-related zinc finger protein. |
| dut protein network | https://string-db.org/network/268739.Nmlp_1542 | dUTP diphosphatase. |
| parA4 protein network | https://string-db.org/network/268739.Nmlp_1545 | ParA domain protein. |
| uraA1 protein network | https://string-db.org/network/268739.Nmlp_1546 | Xanthine/uracil permease family transport protein. |
| apt2 protein network | https://string-db.org/network/268739.Nmlp_1547 | Purine phosphoribosyltransferase (adenine phosphoribosyltransferase, xanthine-guanine phosphoribosyltransferase). |
| pyrE1 protein network | https://string-db.org/network/268739.Nmlp_1548 | Orotate phosphoribosyltransferase; Catalyzes the transfer of a ribosyl phosphate group from 5- phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP). |
| tif1A1 protein network | https://string-db.org/network/268739.Nmlp_1549 | Translation initiation factor aIF-1A; Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-t [...] |
| Nmlp_1550 protein network | https://string-db.org/network/268739.Nmlp_1550 | Uncharacterized protein. |
| kae1 protein network | https://string-db.org/network/268739.Nmlp_1551 | KEOPS complex subunit Kae1/Bud32; Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is a component of [...] |
| rps31e protein network | https://string-db.org/network/268739.Nmlp_1552 | 30S ribosomal protein S31e; Belongs to the eukaryotic ribosomal protein eS31 family. |
| rps24e protein network | https://string-db.org/network/268739.Nmlp_1553 | 30S ribosomal protein S24e; Belongs to the eukaryotic ribosomal protein eS24 family. |
| Nmlp_1554 protein network | https://string-db.org/network/268739.Nmlp_1554 | UPF0218 family protein; Catalyzes the GTP-dependent phosphorylation of the 3'- hydroxyl group of dephosphocoenzyme A to form coenzyme A (CoA). |
| spt4 protein network | https://string-db.org/network/268739.Nmlp_1555 | Transcription elongation factor Spt4; Stimulates transcription elongation; Belongs to the archaeal Spt4 family. |
| rpoE1 protein network | https://string-db.org/network/268739.Nmlp_1556 | DNA-directed RNA polymerase subunit E. |
| Nmlp_1557 protein network | https://string-db.org/network/268739.Nmlp_1557 | DUF188 family protein. |
| tif2c protein network | https://string-db.org/network/268739.Nmlp_1558 | Translation initiation factor aIF-2 gamma subunit; eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. Belongs to the TRAFAC class tr [...] |
| Nmlp_1559 protein network | https://string-db.org/network/268739.Nmlp_1559 | Uncharacterized protein. |
| maa2 protein network | https://string-db.org/network/268739.Nmlp_1560 | O-acetyltransferase (homolog to galactoside O-acetyltransferase). |
| Nmlp_1561 protein network | https://string-db.org/network/268739.Nmlp_1561 | Probable beta-carotene 15,15'-monooxygenase. |
| Nmlp_1562 protein network | https://string-db.org/network/268739.Nmlp_1562 | Tetratricopeptide repeat protein. |
| Nmlp_1563 protein network | https://string-db.org/network/268739.Nmlp_1563 | DUF424 family protein. |
| sppA2 protein network | https://string-db.org/network/268739.Nmlp_1565 | Signal peptide peptidase SppA. |
| Nmlp_1566 protein network | https://string-db.org/network/268739.Nmlp_1566 | GATase domain protein. |
| Nmlp_1567 protein network | https://string-db.org/network/268739.Nmlp_1567 | Histidine kinase. |
| sufS1 protein network | https://string-db.org/network/268739.Nmlp_1568 | Cysteine desulfurase. |
| iscU1 protein network | https://string-db.org/network/268739.Nmlp_1569 | Iron-sulfur cluster assembly protein. |
| panE protein network | https://string-db.org/network/268739.Nmlp_1570 | 2-dehydropantoate 2-reductase; Catalyzes the NADPH-dependent reduction of ketopantoate into pantoic acid. |
| aor3 protein network | https://string-db.org/network/268739.Nmlp_1571 | Aldehyde ferredoxin oxidoreductase. |
| Nmlp_1572 protein network | https://string-db.org/network/268739.Nmlp_1572 | NifU C-terminal domain protein. |
| ahcY protein network | https://string-db.org/network/268739.Nmlp_1573 | Adenosylhomocysteinase; May play a key role in the regulation of the intracellular concentration of adenosylhomocysteine. |
| Nmlp_1574 protein network | https://string-db.org/network/268739.Nmlp_1574 | Uncharacterized protein. |
| mtaD protein network | https://string-db.org/network/268739.Nmlp_1575 | 5-methylthioadenosine/S-adenosylhomocysteine deaminase; Catalyzes the deamination of 5-methylthioadenosine and S- adenosyl-L-homocysteine into 5-methylthioinosine and S-inosyl-L- homocysteine, re [...] |
| Nmlp_1576 protein network | https://string-db.org/network/268739.Nmlp_1576 | Uncharacterized protein. |
| Nmlp_1577 protein network | https://string-db.org/network/268739.Nmlp_1577 | Thioesterase domein protein. |
| Nmlp_1578 protein network | https://string-db.org/network/268739.Nmlp_1578 | JAB domain protein. |
| Nmlp_1579 protein network | https://string-db.org/network/268739.Nmlp_1579 | SSSF family transport protein; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| phoU6 protein network | https://string-db.org/network/268739.Nmlp_1580 | PhoU domain protein. |
| Nmlp_1581 protein network | https://string-db.org/network/268739.Nmlp_1581 | Uncharacterized protein. |
| Nmlp_1582 protein network | https://string-db.org/network/268739.Nmlp_1582 | HTH domain protein. |
| Nmlp_1583 protein network | https://string-db.org/network/268739.Nmlp_1583 | Uncharacterized protein. |
| secY protein network | https://string-db.org/network/268739.Nmlp_1584 | Protein translocase subunit SecY; The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the [...] |
| rpl15 protein network | https://string-db.org/network/268739.Nmlp_1585 | 50S ribosomal protein L15; Binds to the 23S rRNA; Belongs to the universal ribosomal protein uL15 family. |
| rpl30 protein network | https://string-db.org/network/268739.Nmlp_1586 | 50S ribosomal protein L30. |
| rps5 protein network | https://string-db.org/network/268739.Nmlp_1587 | 30S ribosomal protein S5; Belongs to the universal ribosomal protein uS5 family. |
| rpl18 protein network | https://string-db.org/network/268739.Nmlp_1588 | 50S ribosomal protein L18; This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protubera [...] |
| rpl19e protein network | https://string-db.org/network/268739.Nmlp_1589 | 50S ribosomal protein L19e; Binds to the 23S rRNA; Belongs to the eukaryotic ribosomal protein eL19 family. |
| rpl32e protein network | https://string-db.org/network/268739.Nmlp_1590 | 50S ribosomal protein L32e; Belongs to the eukaryotic ribosomal protein eL32 family. |
| rpl6 protein network | https://string-db.org/network/268739.Nmlp_1591 | 50S ribosomal protein L6; This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the t [...] |
| rps8 protein network | https://string-db.org/network/268739.Nmlp_1592 | 30S ribosomal protein S8; One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit; Belongs to [...] |
| rps14 protein network | https://string-db.org/network/268739.Nmlp_1593 | 30S ribosomal protein S14; Binds 16S rRNA, required for the assembly of 30S particles. |
| rpl5 protein network | https://string-db.org/network/268739.Nmlp_1594 | 50S ribosomal protein L5; This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance [...] |
| rps4e protein network | https://string-db.org/network/268739.Nmlp_1595 | 30S ribosomal protein S4e; Belongs to the eukaryotic ribosomal protein eS4 family. |
| rpl24 protein network | https://string-db.org/network/268739.Nmlp_1596 | 50S ribosomal protein L24; Located at the polypeptide exit tunnel on the outside of the subunit. |
| rpl14 protein network | https://string-db.org/network/268739.Nmlp_1597 | 50S ribosomal protein L14; Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome; Belongs to the universal ribosomal protein uL14 family. |
| rps17 protein network | https://string-db.org/network/268739.Nmlp_1598 | 30S ribosomal protein S17; One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA. |
| rnp1 protein network | https://string-db.org/network/268739.Nmlp_1599 | Ribonuclease P protein component 1; Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends; Belongs to the eukaryotic/archaeal RNase P protein co [...] |
| rpl29 protein network | https://string-db.org/network/268739.Nmlp_1600 | 50S ribosomal protein L29; Belongs to the universal ribosomal protein uL29 family. |
| rps3 protein network | https://string-db.org/network/268739.Nmlp_1601 | 30S ribosomal protein S3; Binds the lower part of the 30S subunit head. Belongs to the universal ribosomal protein uS3 family. |
| rpl22 protein network | https://string-db.org/network/268739.Nmlp_1602 | 50S ribosomal protein L22; The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wal [...] |
| rps19 protein network | https://string-db.org/network/268739.Nmlp_1603 | 30S ribosomal protein S19; Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA. |
| rpl2 protein network | https://string-db.org/network/268739.Nmlp_1604 | 50S ribosomal protein L2; One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It [...] |
| rpl23 protein network | https://string-db.org/network/268739.Nmlp_1605 | 50S ribosomal protein L23; Binds to 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Belongs to the universal ribosomal protein uL23 family [...] |
| rpl4 protein network | https://string-db.org/network/268739.Nmlp_1606 | 50S ribosomal protein L4; Forms part of the polypeptide exit tunnel. |
| rpl3 protein network | https://string-db.org/network/268739.Nmlp_1607 | 50S ribosomal protein L3; One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit; Belongs to the universal rib [...] |
| Nmlp_1608 protein network | https://string-db.org/network/268739.Nmlp_1608 | DUF171 family protein. |
| Nmlp_1610 protein network | https://string-db.org/network/268739.Nmlp_1610 | Uncharacterized protein; Product: IS1341-type transposase NmIRS30 (nonfunctional). |
| Nmlp_1611 protein network | https://string-db.org/network/268739.Nmlp_1611 | UPF0045 family protein. |
| Nmlp_1612 protein network | https://string-db.org/network/268739.Nmlp_1612 | DUF2150 family protein. |
| Nmlp_1613 protein network | https://string-db.org/network/268739.Nmlp_1613 | Probable secreted glycoprotein. |
| Nmlp_1614 protein network | https://string-db.org/network/268739.Nmlp_1614 | Uncharacterized protein. |
| Nmlp_1615 protein network | https://string-db.org/network/268739.Nmlp_1615 | DUF3368 domain protein. |
| Nmlp_1616 protein network | https://string-db.org/network/268739.Nmlp_1616 | UPF0175 family protein. |
| Nmlp_1617 protein network | https://string-db.org/network/268739.Nmlp_1617 | DUF433 domain protein. |
| Nmlp_1618 protein network | https://string-db.org/network/268739.Nmlp_1618 | Uncharacterized protein. |
| hmgB protein network | https://string-db.org/network/268739.Nmlp_1619 | hydroxymethylglutaryl-CoA synthase. |
| htr1T protein network | https://string-db.org/network/268739.Nmlp_1620 | Sensory rhodopsin I transducer transmembrane region. |
| Nmlp_1621 protein network | https://string-db.org/network/268739.Nmlp_1621 | Integrase family protein. |
| Nmlp_1622 protein network | https://string-db.org/network/268739.Nmlp_1622 | Uncharacterized protein. |
| Nmlp_1623 protein network | https://string-db.org/network/268739.Nmlp_1623 | Uncharacterized protein. |
| Nmlp_1625 protein network | https://string-db.org/network/268739.Nmlp_1625 | ISH10-type transposase ISNamo3. |
| Nmlp_1626 protein network | https://string-db.org/network/268739.Nmlp_1626 | ISHwa16-type transposase ISNamo14. |
| Nmlp_1628 protein network | https://string-db.org/network/268739.Nmlp_1628 | ISHwa16-type transposase ISNamo15. |
| Nmlp_1630 protein network | https://string-db.org/network/268739.Nmlp_1630 | ISHwa16-type transposase ISNamo14. |
| Nmlp_1632 protein network | https://string-db.org/network/268739.Nmlp_1632 | Receiver/sensor box histidine kinase. |
| Nmlp_1633 protein network | https://string-db.org/network/268739.Nmlp_1633 | Sensor box histidine kinase. |
| Nmlp_1636 protein network | https://string-db.org/network/268739.Nmlp_1636 | Sensor box histidine kinase; Product: IS1341-type transposase NmIRS72 (nonfunctional). |
| hemAT1 protein network | https://string-db.org/network/268739.Nmlp_1637 | Transducer protein HemAT. |
| Nmlp_1639 protein network | https://string-db.org/network/268739.Nmlp_1639 | DUF2800 family protein; Product: ISH8-type transposase NmIRS8 (nonfunctional). |
| Nmlp_1640 protein network | https://string-db.org/network/268739.Nmlp_1640 | Small CPxCG-related zinc finger protein. |
| Nmlp_1641 protein network | https://string-db.org/network/268739.Nmlp_1641 | Small CPxCG-related zinc finger protein. |
| Nmlp_1642 protein network | https://string-db.org/network/268739.Nmlp_1642 | DUF790 family protein. |
| rad25b protein network | https://string-db.org/network/268739.Nmlp_1643 | DNA repair helicase Rad25. |
| Nmlp_1644 protein network | https://string-db.org/network/268739.Nmlp_1644 | Uncharacterized protein. |
| Nmlp_1645 protein network | https://string-db.org/network/268739.Nmlp_1645 | Probable secreted glycoprotein. |
| Nmlp_1646 protein network | https://string-db.org/network/268739.Nmlp_1646 | XerC/D-like integrase. |
| Nmlp_1647 protein network | https://string-db.org/network/268739.Nmlp_1647 | ISH14-type transposase ISNamo13. |
| purL protein network | https://string-db.org/network/268739.Nmlp_1648 | Phosphoribosylformylglycinamidine synthase subunit PurL; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent c [...] |
| Nmlp_1649 protein network | https://string-db.org/network/268739.Nmlp_1649 | PHP domain protein. |
| asnB protein network | https://string-db.org/network/268739.Nmlp_1650 | Asparagine synthase (glutamine-hydrolyzing). |
| Nmlp_1651 protein network | https://string-db.org/network/268739.Nmlp_1651 | Uncharacterized protein. |
| tfbA2 protein network | https://string-db.org/network/268739.Nmlp_1652 | Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB). |
| Nmlp_1653 protein network | https://string-db.org/network/268739.Nmlp_1653 | HTH domain protein. |
| gatC protein network | https://string-db.org/network/268739.Nmlp_1654 | aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu [...] |
| gatA protein network | https://string-db.org/network/268739.Nmlp_1655 | aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A; Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack [...] |
| Nmlp_1656 protein network | https://string-db.org/network/268739.Nmlp_1656 | Abi/CAAX domain protein. |
| Nmlp_1657 protein network | https://string-db.org/network/268739.Nmlp_1657 | Uncharacterized protein. |
| parA5 protein network | https://string-db.org/network/268739.Nmlp_1658 | ParA domain protein. |
| hit2 protein network | https://string-db.org/network/268739.Nmlp_1659 | Histidine triad family protein (homolog to bis(5'-nucleosyl)-tetraphosphatase). |
| Nmlp_1660 protein network | https://string-db.org/network/268739.Nmlp_1660 | Uncharacterized protein. |
| Nmlp_1661 protein network | https://string-db.org/network/268739.Nmlp_1661 | Uncharacterized protein. |
| Nmlp_1662 protein network | https://string-db.org/network/268739.Nmlp_1662 | Rhomboid family protease. |
| nfi protein network | https://string-db.org/network/268739.Nmlp_1663 | Endonuclease 5; DNA repair enzyme involved in the repair of deaminated bases. Selectively cleaves double-stranded DNA at the second phosphodiester bond 3' to a deoxyinosine leaving behind the int [...] |
| Nmlp_1664 protein network | https://string-db.org/network/268739.Nmlp_1664 | Probable oxidoreductase (short-chain dehydrogenase family); Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Nmlp_1665 protein network | https://string-db.org/network/268739.Nmlp_1665 | DUF4147 domain protein. |
| arsA1 protein network | https://string-db.org/network/268739.Nmlp_1666 | ArsA family ATPase. |
| Nmlp_1667 protein network | https://string-db.org/network/268739.Nmlp_1667 | arCOG06342 family protein. |
| scpA protein network | https://string-db.org/network/268739.Nmlp_1668 | Chromosome segregation and condensation protein ScpA. |
| smc protein network | https://string-db.org/network/268739.Nmlp_1669 | Chromosome segregation protein Smc; Required for chromosome condensation and partitioning. Belongs to the SMC family. |
| Nmlp_1670 protein network | https://string-db.org/network/268739.Nmlp_1670 | Uncharacterized protein. |
| hisS protein network | https://string-db.org/network/268739.Nmlp_1671 | histidine--tRNA ligase; Belongs to the class-II aminoacyl-tRNA synthetase family. |
| purU protein network | https://string-db.org/network/268739.Nmlp_1672 | Formyltetrahydrofolate deformylase. |
| Nmlp_1675 protein network | https://string-db.org/network/268739.Nmlp_1675 | Probable oxidoreductase (Aldo-keto reductase family protein); Product: thioredoxin domain protein (nonfunctional). |
| maa1 protein network | https://string-db.org/network/268739.Nmlp_1676 | O-acetyltransferase (homolog to galactoside O-acetyltransferase). |
| acd1 protein network | https://string-db.org/network/268739.Nmlp_1677 | acyl-CoA dehydrogenase. |
| Nmlp_1678 protein network | https://string-db.org/network/268739.Nmlp_1678 | ISH14-type transposase ISNamo8. |
| Nmlp_1679 protein network | https://string-db.org/network/268739.Nmlp_1679 | DUF234 domain protein. |
| vapC protein network | https://string-db.org/network/268739.Nmlp_1682 | Homolog to endonuclease VapC; Toxic component of a toxin-antitoxin (TA) system. An RNase. Belongs to the PINc/VapC protein family. |
| Nmlp_1683 protein network | https://string-db.org/network/268739.Nmlp_1683 | Homolog to antitoxin VapB. |
| Nmlp_1684 protein network | https://string-db.org/network/268739.Nmlp_1684 | PadR family transcription regulator. |
| Nmlp_1685 protein network | https://string-db.org/network/268739.Nmlp_1685 | Uncharacterized protein. |
| Nmlp_1686 protein network | https://string-db.org/network/268739.Nmlp_1686 | Uncharacterized protein. |
| Nmlp_1687 protein network | https://string-db.org/network/268739.Nmlp_1687 | Uncharacterized protein. |
| Nmlp_1688 protein network | https://string-db.org/network/268739.Nmlp_1688 | Uncharacterized protein. |
| Nmlp_1689 protein network | https://string-db.org/network/268739.Nmlp_1689 | ISH14-type transposase ISNamo11. |
| Nmlp_1690 protein network | https://string-db.org/network/268739.Nmlp_1690 | SirR/DtxR family transcription regulator. |
| Nmlp_1691 protein network | https://string-db.org/network/268739.Nmlp_1691 | Ferritin domain protein. |
| sufB2 protein network | https://string-db.org/network/268739.Nmlp_1692 | SufB domain protein. |
| sufB1 protein network | https://string-db.org/network/268739.Nmlp_1693 | SufB domain protein. |
| sufC protein network | https://string-db.org/network/268739.Nmlp_1694 | Fe-S cluster assembly ATPase SufC. |
| polB protein network | https://string-db.org/network/268739.Nmlp_1695 | DNA-directed DNA polymerase B (intein-containing). |
| Nmlp_1696 protein network | https://string-db.org/network/268739.Nmlp_1696 | Uncharacterized protein. |
| Nmlp_1697 protein network | https://string-db.org/network/268739.Nmlp_1697 | Uncharacterized protein. |
| Nmlp_1698 protein network | https://string-db.org/network/268739.Nmlp_1698 | HTH domain protein. |
| rad50 protein network | https://string-db.org/network/268739.Nmlp_1699 | DNA double-strand break repair ATPase Rad50; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Rad50 controls the balance between DNA [...] |
| mre11 protein network | https://string-db.org/network/268739.Nmlp_1700 | DNA double-strand break repair protein Mre11; Part of the Rad50/Mre11 complex, which is involved in the early steps of DNA double-strand break (DSB) repair. Mre11 binds to DSB ends and has both d [...] |
| Nmlp_1701 protein network | https://string-db.org/network/268739.Nmlp_1701 | Uncharacterized protein. |
| Nmlp_1702 protein network | https://string-db.org/network/268739.Nmlp_1702 | NP_1176A family transcription regulator. |
| pan2 protein network | https://string-db.org/network/268739.Nmlp_1703 | Proteasome-activating nucleotidase; ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is esse [...] |
| Nmlp_1704 protein network | https://string-db.org/network/268739.Nmlp_1704 | Uncharacterized protein. |
| Nmlp_1705 protein network | https://string-db.org/network/268739.Nmlp_1705 | Uncharacterized protein. |
| Nmlp_1706 protein network | https://string-db.org/network/268739.Nmlp_1706 | DUF583 domain protein. |
| Nmlp_1707 protein network | https://string-db.org/network/268739.Nmlp_1707 | GTP-binding protein. |
| Nmlp_1710 protein network | https://string-db.org/network/268739.Nmlp_1710 | Homolog to restriction system mrr. |
| Nmlp_1713 protein network | https://string-db.org/network/268739.Nmlp_1713 | Probable RfbX family transport protein; Product: IS1341-type transposase NmIRS26 (nonfunctional). |
| Nmlp_1715 protein network | https://string-db.org/network/268739.Nmlp_1715 | Methyltranf_PUA domain-containing protein; Gene is interrupted (insert,in-frame stop) and is truncated at both termini; locus_tag: Nmlp_1714; product: ATP-dependent helicase (nonfunctional). |
| cna protein network | https://string-db.org/network/268739.Nmlp_1716 | tRNA/rRNA cytosine-C5-methylase; Belongs to the class I-like SAM-binding methyltransferase superfamily. RsmB/NOP family. |
| Nmlp_1717 protein network | https://string-db.org/network/268739.Nmlp_1717 | PAC2 family protein. |
| Nmlp_1718 protein network | https://string-db.org/network/268739.Nmlp_1718 | DUF88 family protein. |
| Nmlp_1719 protein network | https://string-db.org/network/268739.Nmlp_1719 | M20 family amidohydrolase (homolog to indole-3-acetyl-aspartate hydrolase). |
| rps10b protein network | https://string-db.org/network/268739.Nmlp_1720 | 30S ribosomal protein S10b; Involved in the binding of tRNA to the ribosomes. Belongs to the universal ribosomal protein uS10 family. |
| Nmlp_1721 protein network | https://string-db.org/network/268739.Nmlp_1721 | NUDIX family hydrolase. |
| Nmlp_1722 protein network | https://string-db.org/network/268739.Nmlp_1722 | HesB/IscA family iron-sulfur cluster assembly accessory protein. |
| Nmlp_1724 protein network | https://string-db.org/network/268739.Nmlp_1724 | tRNA-Val; anticodon=CAC. |
| Nmlp_1725 protein network | https://string-db.org/network/268739.Nmlp_1725 | ABC-type transport system permease protein. |
| Nmlp_1728 protein network | https://string-db.org/network/268739.Nmlp_1728 | ISH11-type transposase ISNamo4. |
| Nmlp_1729 protein network | https://string-db.org/network/268739.Nmlp_1729 | Uncharacterized protein. |
| aldH3 protein network | https://string-db.org/network/268739.Nmlp_1730 | Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| Nmlp_1733 protein network | https://string-db.org/network/268739.Nmlp_1733 | Probable DEAD/DEAH box helicase. |
| Nmlp_1734 protein network | https://string-db.org/network/268739.Nmlp_1734 | Gene has been targetted by a transposon; locus_tag: Nmlp_1735; product: homolog to modification methylase (nonfunctional); conceptual translation after in silico reconstruction: MSEKVTDETENSESKAP [...] |
| Nmlp_1736 protein network | https://string-db.org/network/268739.Nmlp_1736 | Uncharacterized protein. |
| Nmlp_1737 protein network | https://string-db.org/network/268739.Nmlp_1737 | DUF499 domain protein. |
| Nmlp_1738 protein network | https://string-db.org/network/268739.Nmlp_1738 | Homolog to phage integrase. |
| Nmlp_1739 protein network | https://string-db.org/network/268739.Nmlp_1739 | Uncharacterized protein. |
| Nmlp_1740 protein network | https://string-db.org/network/268739.Nmlp_1740 | Uncharacterized protein. |
| Nmlp_1741 protein network | https://string-db.org/network/268739.Nmlp_1741 | Uncharacterized protein. |
| cre3c protein network | https://string-db.org/network/268739.Nmlp_1743 | Creatininase domain protein. |
| Nmlp_1744 protein network | https://string-db.org/network/268739.Nmlp_1744 | Uncharacterized protein. |
| Nmlp_1745 protein network | https://string-db.org/network/268739.Nmlp_1745 | Uncharacterized protein. |
| Nmlp_1746 protein network | https://string-db.org/network/268739.Nmlp_1746 | Uncharacterized protein. |
| atoE protein network | https://string-db.org/network/268739.Nmlp_1747 | AtoE family transport protein. |
| Nmlp_1748 protein network | https://string-db.org/network/268739.Nmlp_1748 | Uncharacterized protein; Product: XerC/D-like integrase (nonfunctional). |
| Nmlp_1749 protein network | https://string-db.org/network/268739.Nmlp_1749 | Uncharacterized protein. |
| Nmlp_1750 protein network | https://string-db.org/network/268739.Nmlp_1750 | Uncharacterized protein. |
| Nmlp_1751 protein network | https://string-db.org/network/268739.Nmlp_1751 | IS1341-type transposase ISNamo23. |
| Nmlp_1752 protein network | https://string-db.org/network/268739.Nmlp_1752 | Lrp/AsnC family transcription regulator. |
| gvpO protein network | https://string-db.org/network/268739.Nmlp_1753 | Gas-vesicle operon protein GvpO. |
| gvpN protein network | https://string-db.org/network/268739.Nmlp_1754 | Gas-vesicle operon protein GvpN. |
| gvpC protein network | https://string-db.org/network/268739.Nmlp_1755 | Gas-vesicle minor protein GvpC. |
| gvpA protein network | https://string-db.org/network/268739.Nmlp_1756 | Gas-vesicle major structural protein GvpA; Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning [...] |
| gvpD protein network | https://string-db.org/network/268739.Nmlp_1757 | Regulatory protein GvpD. |
| Nmlp_1759 protein network | https://string-db.org/network/268739.Nmlp_1759 | ISHwa16-type transposase ISNamo14. |
| gvpE protein network | https://string-db.org/network/268739.Nmlp_1760 | PadR family transcription activator GvpE. |
| gvpF protein network | https://string-db.org/network/268739.Nmlp_1761 | Gas-vesicle-associated protein GvpF. |
| gvpG protein network | https://string-db.org/network/268739.Nmlp_1762 | Gas-vesicle-associated protein GvpG. |
| gvpH protein network | https://string-db.org/network/268739.Nmlp_1763 | Gas-vesicle operon protein GvpH. |
| gvpI protein network | https://string-db.org/network/268739.Nmlp_1764 | Gas-vesicle operon protein GvpI. |
| gvpJ protein network | https://string-db.org/network/268739.Nmlp_1765 | Gas-vesicle-associated protein GvpJ; Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the [...] |
| gvpK protein network | https://string-db.org/network/268739.Nmlp_1766 | Gas-vesicle operon protein GvpK. |
| gvpL protein network | https://string-db.org/network/268739.Nmlp_1767 | Gas-vesicle-associated protein GvpL. |
| gvpM protein network | https://string-db.org/network/268739.Nmlp_1768 | Gas-vesicle-associated protein GvpM. |
| Nmlp_1770 protein network | https://string-db.org/network/268739.Nmlp_1770 | Product: DUF234 domain protein (nonfunctional). |
| Nmlp_1771 protein network | https://string-db.org/network/268739.Nmlp_1771 | PIN domain protein. |
| aroQ protein network | https://string-db.org/network/268739.Nmlp_1772 | Chorismate mutase. |
| aroK protein network | https://string-db.org/network/268739.Nmlp_1773 | Shikimate kinase, archaeal-type. |
| Nmlp_1774 protein network | https://string-db.org/network/268739.Nmlp_1774 | Glyoxalase domain protein. |
| Nmlp_1775 protein network | https://string-db.org/network/268739.Nmlp_1775 | Homolog to archaease. |
| Nmlp_1776 protein network | https://string-db.org/network/268739.Nmlp_1776 | Homolog to sodium/calcium antiporter. |
| Nmlp_1777 protein network | https://string-db.org/network/268739.Nmlp_1777 | ABC-type transport system accessory transmembrane protein. |
| Nmlp_1778 protein network | https://string-db.org/network/268739.Nmlp_1778 | ABC-type transport system permease protein. |
| Nmlp_1780 protein network | https://string-db.org/network/268739.Nmlp_1780 | GNAT family acetyltransferase. |
| priS protein network | https://string-db.org/network/268739.Nmlp_1781 | DNA primase small subunit; Catalytic subunit of DNA primase, an RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. The s [...] |
| ginS protein network | https://string-db.org/network/268739.Nmlp_1782 | DNA replication factor GINS. |
| Nmlp_1783 protein network | https://string-db.org/network/268739.Nmlp_1783 | Uncharacterized protein. |
| cdc48b protein network | https://string-db.org/network/268739.Nmlp_1784 | AAA-type ATPase (CDC48 subfamily). |
| Nmlp_1785 protein network | https://string-db.org/network/268739.Nmlp_1785 | Small CPxCG-related zinc finger protein. |
| Tif2Bd protein network | https://string-db.org/network/268739.Nmlp_1786 | eIF-2B domain protein; Belongs to the eIF-2B alpha/beta/delta subunits family. |
| lhr1 protein network | https://string-db.org/network/268739.Nmlp_1787 | ATP-dependent DNA helicase. |
| trxA4 protein network | https://string-db.org/network/268739.Nmlp_1789 | Thioredoxin; Product: UspA domain protein (nonfunctional). |
| Nmlp_1790 protein network | https://string-db.org/network/268739.Nmlp_1790 | Uncharacterized protein. |
| ferA2 protein network | https://string-db.org/network/268739.Nmlp_1791 | Ferredoxin (2Fe-2S). |
| mutS5b protein network | https://string-db.org/network/268739.Nmlp_1792 | DNA mismatch repair protein MutS. |
| Nmlp_1793 protein network | https://string-db.org/network/268739.Nmlp_1793 | DUF814 domain protein. |
| Nmlp_1794 protein network | https://string-db.org/network/268739.Nmlp_1794 | DUF4013 family protein. |
| pelA protein network | https://string-db.org/network/268739.Nmlp_1795 | mRNA surveillance protein pelota; May function in recognizing stalled ribosomes, interact with stem-loop structures in stalled mRNA molecules, and effect endonucleolytic cleavage of the mRNA. May [...] |
| Nmlp_1796 protein network | https://string-db.org/network/268739.Nmlp_1796 | Homolog to ribonuclease Z. |
| lhr2 protein network | https://string-db.org/network/268739.Nmlp_1798 | ATP-dependent DNA helicase; Gene has a frameshift; locus_tag: Nmlp_1797; product: uncharacterized protein (nonfunctional); conceptual translation after in silico reconstruction: MVPDSPPSTLRDRLPAE [...] |
| thrC1 protein network | https://string-db.org/network/268739.Nmlp_1801 | Threonine synthase; Catalyzes the gamma-elimination of phosphate from L- phosphohomoserine and the beta-addition of water to produce L- threonine. |
| Nmlp_1802 protein network | https://string-db.org/network/268739.Nmlp_1802 | Uncharacterized protein. |
| Nmlp_1803 protein network | https://string-db.org/network/268739.Nmlp_1803 | Uncharacterized protein. |
| Nmlp_1804 protein network | https://string-db.org/network/268739.Nmlp_1804 | TrmB family transcription regulator; Product: IS1341-type transposase NmIRS69 (nonfunctional). |
| Nmlp_1805 protein network | https://string-db.org/network/268739.Nmlp_1805 | Alpha/beta hydrolase fold protein. |
| Nmlp_1806 protein network | https://string-db.org/network/268739.Nmlp_1806 | Small CPxCG-related zinc finger protein. |
| uvrD protein network | https://string-db.org/network/268739.Nmlp_1807 | Repair helicase UvrD. |
| Nmlp_1808 protein network | https://string-db.org/network/268739.Nmlp_1808 | RIO-type protein kinase domain protein. |
| Nmlp_1809 protein network | https://string-db.org/network/268739.Nmlp_1809 | ISH14-type transposase ISNamo8. |
| purF protein network | https://string-db.org/network/268739.Nmlp_1810 | Amidophosphoribosyltransferase; Catalyzes the formation of phosphoribosylamine from phosphoribosylpyrophosphate (PRPP) and glutamine. |
| rpl37e protein network | https://string-db.org/network/268739.Nmlp_1811 | 50S ribosomal protein L37e; Binds to the 23S rRNA; Belongs to the eukaryotic ribosomal protein eL37 family. |
| lsm protein network | https://string-db.org/network/268739.Nmlp_1812 | RNA-binding protein Lsm. |
| Nmlp_1813 protein network | https://string-db.org/network/268739.Nmlp_1813 | Peptidase M42 family protein. |
| Nmlp_1814 protein network | https://string-db.org/network/268739.Nmlp_1814 | Uncharacterized protein. |
| rio2 protein network | https://string-db.org/network/268739.Nmlp_1815 | RIO-type serine/threonine protein kinase Rio2. |
| vapB1 protein network | https://string-db.org/network/268739.Nmlp_1816 | Probable VapB/AbrB family antitoxin. |
| vapC1 protein network | https://string-db.org/network/268739.Nmlp_1817 | Probable ribonuclease VapC; Toxic component of a toxin-antitoxin (TA) system. An RNase. Belongs to the PINc/VapC protein family. |
| rpl15e protein network | https://string-db.org/network/268739.Nmlp_1818 | 50S ribosomal protein L15e; Belongs to the eukaryotic ribosomal protein eL15 family. |
| Nmlp_1819 protein network | https://string-db.org/network/268739.Nmlp_1819 | M50 family metalloprotease; Belongs to the peptidase M50B family. |
| Nmlp_1820 protein network | https://string-db.org/network/268739.Nmlp_1820 | Uncharacterized protein. |
| Nmlp_1821 protein network | https://string-db.org/network/268739.Nmlp_1821 | Uncharacterized protein. |
| Nmlp_1822 protein network | https://string-db.org/network/268739.Nmlp_1822 | AhpD family protein. |
| Nmlp_1823 protein network | https://string-db.org/network/268739.Nmlp_1823 | UPF0721 family protein. |
| CCQ36011.1 protein network | https://string-db.org/network/268739.Nmlp_1823A | Uncharacterized protein. |
| Nmlp_1824 protein network | https://string-db.org/network/268739.Nmlp_1824 | Uncharacterized protein. |
| bdhA1 protein network | https://string-db.org/network/268739.Nmlp_1825 | 3-hydroxybutyrate dehydrogenase. |
| Nmlp_1826 protein network | https://string-db.org/network/268739.Nmlp_1826 | Poly(3-hydroxybutyrate) depolymerase. |
| Nmlp_1827 protein network | https://string-db.org/network/268739.Nmlp_1827 | Uncharacterized protein. |
| lpdA2 protein network | https://string-db.org/network/268739.Nmlp_1828 | Dihydrolipoyl dehydrogenase. |
| Nmlp_1829 protein network | https://string-db.org/network/268739.Nmlp_1829 | TrmB family transcription regulator. |
| Nmlp_1830 protein network | https://string-db.org/network/268739.Nmlp_1830 | Uncharacterized protein. |
| pchB protein network | https://string-db.org/network/268739.Nmlp_1831 | PhoU/TrkA-C domain protein. |
| MgtE1 protein network | https://string-db.org/network/268739.Nmlp_1832 | MgtE family transport protein. |
| MgtE2 protein network | https://string-db.org/network/268739.Nmlp_1833 | MgtE family transport protein. |
| Nmlp_1834 protein network | https://string-db.org/network/268739.Nmlp_1834 | Uncharacterized protein. |
| mutS1a protein network | https://string-db.org/network/268739.Nmlp_1835 | DNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. It is possible that it carries out the mismatch recognition step. This protein has a weak ATPase act [...] |
| nucS protein network | https://string-db.org/network/268739.Nmlp_1836 | Endonuclease NucS; Cleaves both 3' and 5' ssDNA extremities of branched DNA structures; Belongs to the NucS endonuclease family. |
| Nmlp_1837 protein network | https://string-db.org/network/268739.Nmlp_1837 | Uncharacterized protein. |
| Nmlp_1838 protein network | https://string-db.org/network/268739.Nmlp_1838 | SSSF family transport protein; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| tenA1 protein network | https://string-db.org/network/268739.Nmlp_1839 | Aminopyrimidine aminohydrolase. |
| thiN2 protein network | https://string-db.org/network/268739.Nmlp_1840 | HTH domain protein / thiamine-phosphate synthase. |
| Nmlp_1842 protein network | https://string-db.org/network/268739.Nmlp_1842 | Product: thioredoxin domain protein (nonfunctional). |
| Nmlp_1843 protein network | https://string-db.org/network/268739.Nmlp_1843 | HTH domain protein. |
| Nmlp_1844 protein network | https://string-db.org/network/268739.Nmlp_1844 | Uncharacterized protein. |
| Nmlp_1845 protein network | https://string-db.org/network/268739.Nmlp_1845 | DUF4013 family protein. |
| Nmlp_1846 protein network | https://string-db.org/network/268739.Nmlp_1846 | Uncharacterized protein. |
| Nmlp_1847 protein network | https://string-db.org/network/268739.Nmlp_1847 | ISH14-type transposase ISNamo9. |
| Nmlp_1848 protein network | https://string-db.org/network/268739.Nmlp_1848 | Probable oxidoreductase (short-chain dehydrogenase family). |
| Nmlp_1849 protein network | https://string-db.org/network/268739.Nmlp_1849 | UPF0104 family protein. |
| gtl7 protein network | https://string-db.org/network/268739.Nmlp_1850 | Probable glycosyltransferase, type 2. |
| glpA2 protein network | https://string-db.org/network/268739.Nmlp_1851 | Glycerol-3-phosphate dehydrogenase subunit A; Belongs to the FAD-dependent glycerol-3-phosphate dehydrogenase family. |
| ferA4 protein network | https://string-db.org/network/268739.Nmlp_1852 | Ferredoxin (2Fe-2S). |
| Nmlp_1853 protein network | https://string-db.org/network/268739.Nmlp_1853 | IS1341-type transposase ISNamo21; Gene has been targetted by a transposon; locus_tag: Nmlp_1855; conceptual translation after in silico reconstruction: MSTDNSDDTTEHHAHEHRDVGGPGYPTPAAMRTESGREQTAYV [...] |
| Nmlp_1854 protein network | https://string-db.org/network/268739.Nmlp_1854 | Uncharacterized protein. |
| Nmlp_1856 protein network | https://string-db.org/network/268739.Nmlp_1856 | Probable oxidoreductase (homolog to saccharopine dehydrogenase). |
| thrS protein network | https://string-db.org/network/268739.Nmlp_1857 | threonine--tRNA ligase; Belongs to the class-II aminoacyl-tRNA synthetase family. |
| Nmlp_1858 protein network | https://string-db.org/network/268739.Nmlp_1858 | Uncharacterized protein. |
| Nmlp_1859 protein network | https://string-db.org/network/268739.Nmlp_1859 | Uncharacterized protein. |
| Nmlp_1860 protein network | https://string-db.org/network/268739.Nmlp_1860 | KaiC domain protein. |
| nadK1 protein network | https://string-db.org/network/268739.Nmlp_1861 | Probable NAD kinase (polyphosphate/ATP); Involved in the regulation of the intracellular balance of NAD and NADP, and is a key enzyme in the biosynthesis of NADP. Catalyzes specifically the phosp [...] |
| mptA protein network | https://string-db.org/network/268739.Nmlp_1862 | GTP cyclohydrolase MptA; Converts GTP to 7,8-dihydro-D-neopterin 2',3'-cyclic phosphate, the first intermediate in the biosynthesis of coenzyme methanopterin. |
| Nmlp_1863 protein network | https://string-db.org/network/268739.Nmlp_1863 | YyaL family protein. |
| secD protein network | https://string-db.org/network/268739.Nmlp_1864 | Protein-export membrane protein SecD; Involved in protein export. |
| secF protein network | https://string-db.org/network/268739.Nmlp_1865 | Protein-export membrane protein SecF; Involved in protein export. |
| hcp2 protein network | https://string-db.org/network/268739.Nmlp_1866 | Halocyanin. |
| assA protein network | https://string-db.org/network/268739.Nmlp_1867 | Probable archaetidylserine synthase; Belongs to the CDP-alcohol phosphatidyltransferase class-I family. |
| Nmlp_1868 protein network | https://string-db.org/network/268739.Nmlp_1868 | HEAT-PBS family protein. |
| ppc protein network | https://string-db.org/network/268739.Nmlp_1869 | Phosphoenolpyruvate carboxylase. |
| Nmlp_1870 protein network | https://string-db.org/network/268739.Nmlp_1870 | Phospholipase D domain protein. |
| Nmlp_1871 protein network | https://string-db.org/network/268739.Nmlp_1871 | DHH/RecJ family phosphoesterase. |
| Nmlp_1872 protein network | https://string-db.org/network/268739.Nmlp_1872 | JAB domain protein. |
| ribL protein network | https://string-db.org/network/268739.Nmlp_1873 | FAD synthase; Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme. |
| gth1 protein network | https://string-db.org/network/268739.Nmlp_1874 | Probable glycosyltransferase, type 1. |
| gth2 protein network | https://string-db.org/network/268739.Nmlp_1875 | Probable glycosyltransferase, type 1. |
| Nmlp_1876 protein network | https://string-db.org/network/268739.Nmlp_1876 | Amine oxidase domain protein. |
| Nmlp_1877 protein network | https://string-db.org/network/268739.Nmlp_1877 | AI-2E family transport protein. |
| Nmlp_1878 protein network | https://string-db.org/network/268739.Nmlp_1878 | Uncharacterized protein. |
| Nmlp_1879 protein network | https://string-db.org/network/268739.Nmlp_1879 | Flavin-dependent pyridine nucleotide oxidoreductase. |
| Nmlp_1880 protein network | https://string-db.org/network/268739.Nmlp_1880 | Uncharacterized protein. |
| Nmlp_1881 protein network | https://string-db.org/network/268739.Nmlp_1881 | Uncharacterized protein. |
| Nmlp_1882 protein network | https://string-db.org/network/268739.Nmlp_1882 | Uncharacterized protein. |
| Nmlp_1883 protein network | https://string-db.org/network/268739.Nmlp_1883 | Uncharacterized protein. |
| Nmlp_1884 protein network | https://string-db.org/network/268739.Nmlp_1884 | GtrA family protein. |
| gtl3 protein network | https://string-db.org/network/268739.Nmlp_1885 | Probable glycosyltransferase, type 2. |
| Nmlp_1886 protein network | https://string-db.org/network/268739.Nmlp_1886 | DUF2298 family protein. |
| pcc1 protein network | https://string-db.org/network/268739.Nmlp_1887 | KEOPS complex subunit Pcc1. |
| rpoP protein network | https://string-db.org/network/268739.Nmlp_1888 | DNA-directed RNA polymerase subunit P; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...] |
| rpl43e protein network | https://string-db.org/network/268739.Nmlp_1889 | 50S ribosomal protein L43e. |
| Nmlp_1890 protein network | https://string-db.org/network/268739.Nmlp_1890 | DUF2103 family protein. |
| truD protein network | https://string-db.org/network/268739.Nmlp_1891 | tRNA pseudouridine(13) synthase TruD; Could be responsible for synthesis of pseudouridine from uracil-13 in transfer RNAs; Belongs to the pseudouridine synthase TruD family. |
| Nmlp_1892 protein network | https://string-db.org/network/268739.Nmlp_1892 | NamA family oxidoreductase. |
| pth protein network | https://string-db.org/network/268739.Nmlp_1893 | peptidyl-tRNA hydrolase. |
| gtl5 protein network | https://string-db.org/network/268739.Nmlp_1894 | Probable glycosyltransferase, type 2. |
| Nmlp_1895 protein network | https://string-db.org/network/268739.Nmlp_1895 | Homolog to NAD-dependent epimerase/dehydratase. |
| Nmlp_1896 protein network | https://string-db.org/network/268739.Nmlp_1896 | Uncharacterized protein. |
| Nmlp_1897 protein network | https://string-db.org/network/268739.Nmlp_1897 | Uncharacterized protein. |
| Nmlp_1898 protein network | https://string-db.org/network/268739.Nmlp_1898 | Uncharacterized protein. |
| Nmlp_1899 protein network | https://string-db.org/network/268739.Nmlp_1899 | Uncharacterized protein. |
| Nmlp_1900 protein network | https://string-db.org/network/268739.Nmlp_1900 | Uncharacterized protein. |
| Nmlp_1901 protein network | https://string-db.org/network/268739.Nmlp_1901 | Type IV pilus biogenesis complex membrane subunit. |
| Nmlp_1902 protein network | https://string-db.org/network/268739.Nmlp_1902 | Type IV pilus biogenesis complex ATPase subunit. |
| Nmlp_1903 protein network | https://string-db.org/network/268739.Nmlp_1903 | Uncharacterized protein. |
| Nmlp_1904 protein network | https://string-db.org/network/268739.Nmlp_1904 | Uncharacterized protein. |
| Nmlp_1905 protein network | https://string-db.org/network/268739.Nmlp_1905 | IS1341-type transposase ISNamo23. |
| Nmlp_1906 protein network | https://string-db.org/network/268739.Nmlp_1906 | Uncharacterized protein. |
| cat2 protein network | https://string-db.org/network/268739.Nmlp_1907 | Transport protein (probable substrate cationic amino acids). |
| Nmlp_1908 protein network | https://string-db.org/network/268739.Nmlp_1908 | Probable phosphodiesterase. |
| Nmlp_1909 protein network | https://string-db.org/network/268739.Nmlp_1909 | Uncharacterized protein. |
| Nmlp_1912 protein network | https://string-db.org/network/268739.Nmlp_1912 | LpxA family protein. |
| phnE protein network | https://string-db.org/network/268739.Nmlp_1913 | ABC-type transport system permease protein (probable substrate phosphate/phosphonate). |
| phnC protein network | https://string-db.org/network/268739.Nmlp_1914 | ABC-type transport system ATP-binding protein (probable substrate phosphate/phosphonate); Part of the ABC transporter complex PhnCDE involved in phosphonates import. Responsible for energy coupli [...] |
| phnD protein network | https://string-db.org/network/268739.Nmlp_1915 | ABC-type transport system periplasmic substrate-binding protein (probable substrate phosphate/phosphonate). |
| phnG protein network | https://string-db.org/network/268739.Nmlp_1916 | Alkylphosphonate cleavage complex subunit PhnG. |
| phnH protein network | https://string-db.org/network/268739.Nmlp_1917 | Alkylphosphonate cleavage complex subunit PhnH. |
| phnI protein network | https://string-db.org/network/268739.Nmlp_1918 | alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase PhnI. |
| phnJ protein network | https://string-db.org/network/268739.Nmlp_1919 | alpha-D-ribose 1-methylphosphonate 5-phosphate C-P lyase. |
| phnK protein network | https://string-db.org/network/268739.Nmlp_1920 | Alkylphosphonate cleavage complex subunit PhnK. |
| phnL protein network | https://string-db.org/network/268739.Nmlp_1921 | Alkylphosphonate cleavage complex subunit PhnL. |
| phnM protein network | https://string-db.org/network/268739.Nmlp_1922 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase. |
| Nmlp_1923 protein network | https://string-db.org/network/268739.Nmlp_1923 | YfiH family protein. |
| Nmlp_1924 protein network | https://string-db.org/network/268739.Nmlp_1924 | HAD superfamily hydrolase. |
| Nmlp_1928 protein network | https://string-db.org/network/268739.Nmlp_1928 | Uncharacterized protein; Product: ISH3-type transposase NmIRS14 (nonfunctional). |
| Nmlp_1929 protein network | https://string-db.org/network/268739.Nmlp_1929 | Uncharacterized protein. |
| Nmlp_1930 protein network | https://string-db.org/network/268739.Nmlp_1930 | Probable coiled coil protein. |
| Nmlp_1931 protein network | https://string-db.org/network/268739.Nmlp_1931 | Uncharacterized protein. |
| Nmlp_1932 protein network | https://string-db.org/network/268739.Nmlp_1932 | Uncharacterized protein. |
| Nmlp_1933 protein network | https://string-db.org/network/268739.Nmlp_1933 | ISH9-type transposase ISNamo1. |
| Nmlp_1937 protein network | https://string-db.org/network/268739.Nmlp_1937 | Uncharacterized protein; Gene has a frameshift and is truncated at both termini; locus_tag: Nmlp_1936; product: ISH11-type transposase NmIRS9 (nonfunctional). |
| Nmlp_1938 protein network | https://string-db.org/network/268739.Nmlp_1938 | ArsR family transcription regulator. |
| Nmlp_1939 protein network | https://string-db.org/network/268739.Nmlp_1939 | Uncharacterized protein. |
| Nmlp_1940 protein network | https://string-db.org/network/268739.Nmlp_1940 | Uncharacterized protein. |
| apbE protein network | https://string-db.org/network/268739.Nmlp_1941 | Flavin transferase ApbE. |
| Nmlp_1942 protein network | https://string-db.org/network/268739.Nmlp_1942 | Glutamate/aspartate-rich protein. |
| trm56 protein network | https://string-db.org/network/268739.Nmlp_1943 | tRNA (cytidine(56)-2'-O)-methyltransferase; Specifically catalyzes the AdoMet-dependent 2'-O-ribose methylation of cytidine at position 56 in tRNAs; Belongs to the aTrm56 family. |
| Nmlp_1944 protein network | https://string-db.org/network/268739.Nmlp_1944 | GalE family epimerase/dehydratase. |
| Nmlp_1945 protein network | https://string-db.org/network/268739.Nmlp_1945 | BsuPI domain protein. |
| Nmlp_1947 protein network | https://string-db.org/network/268739.Nmlp_1947 | Uncharacterized protein. |
| Nmlp_1948 protein network | https://string-db.org/network/268739.Nmlp_1948 | DUF2797 family protein. |
| Nmlp_1949 protein network | https://string-db.org/network/268739.Nmlp_1949 | Glycine-rich protein. |
| aspC3 protein network | https://string-db.org/network/268739.Nmlp_1951 | Pyridoxal phosphate-dependent aminotransferase. |
| ribH protein network | https://string-db.org/network/268739.Nmlp_1952 | 6,7-dimethyl-8-ribityllumazine synthase; Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2- butanone 4-phosphate. [...] |
| rpl11 protein network | https://string-db.org/network/268739.Nmlp_1953 | 50S ribosomal protein L11; Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors; Belongs to the universal ribosomal protein uL11 family. |
| Nmlp_1954 protein network | https://string-db.org/network/268739.Nmlp_1954 | Uncharacterized protein. |
| drg protein network | https://string-db.org/network/268739.Nmlp_1955 | GTP-binding protein Drg. |
| Nmlp_1956 protein network | https://string-db.org/network/268739.Nmlp_1956 | DUF2391 family protein. |
| artA protein network | https://string-db.org/network/268739.Nmlp_1957 | Archaeosortase A. |
| Nmlp_1958 protein network | https://string-db.org/network/268739.Nmlp_1958 | Uncharacterized protein. |
| dph5 protein network | https://string-db.org/network/268739.Nmlp_1959 | Diphthine synthase; S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation fac [...] |
| tfbA5 protein network | https://string-db.org/network/268739.Nmlp_1960 | Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB). |
| Nmlp_1961 protein network | https://string-db.org/network/268739.Nmlp_1961 | Small CPxCG-related zinc finger protein. |
| Nmlp_1962 protein network | https://string-db.org/network/268739.Nmlp_1962 | DUF420 family protein. |
| Nmlp_1963 protein network | https://string-db.org/network/268739.Nmlp_1963 | Sensor box histidine kinase. |
| Nmlp_1964 protein network | https://string-db.org/network/268739.Nmlp_1964 | Receiver/sensor/bat box HTH-10 family transcription regulator. |
| Nmlp_1966 protein network | https://string-db.org/network/268739.Nmlp_1966 | DUF86 family protein. |
| Nmlp_1967 protein network | https://string-db.org/network/268739.Nmlp_1967 | Nucleotidyltransferase domain protein. |
| Nmlp_1968 protein network | https://string-db.org/network/268739.Nmlp_1968 | Probable secreted glycoprotein. |
| Nmlp_1969 protein network | https://string-db.org/network/268739.Nmlp_1969 | tRNA-Leu; anticodon=GAG. |
| Nmlp_1970 protein network | https://string-db.org/network/268739.Nmlp_1970 | Uncharacterized protein. |
| panB protein network | https://string-db.org/network/268739.Nmlp_1971 | 3-methyl-2-oxobutanoate hydroxymethyltransferase; Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha- ketoisovalerate to [...] |
| Nmlp_1972 protein network | https://string-db.org/network/268739.Nmlp_1972 | ABC-type transport system ATP-binding protein. |
| Nmlp_1973 protein network | https://string-db.org/network/268739.Nmlp_1973 | ABC-type transport system permease protein. |
| cbs6 protein network | https://string-db.org/network/268739.Nmlp_1974 | CBS domain protein. |
| Nmlp_1975 protein network | https://string-db.org/network/268739.Nmlp_1975 | Homolog to small CPxCG-related zinc finger protein. |
| Nmlp_1976 protein network | https://string-db.org/network/268739.Nmlp_1976 | RimK family protein. |
| Nmlp_1977 protein network | https://string-db.org/network/268739.Nmlp_1977 | AstE domain protein. |
| sdhC protein network | https://string-db.org/network/268739.Nmlp_1978 | Succinate dehydrogenase subunit C; Deleted EC_number 1.3.99.1. |
| sdhD protein network | https://string-db.org/network/268739.Nmlp_1979 | Succinate dehydrogenase subunit D; Deleted EC_number 1.3.99.1. |
| sdhB protein network | https://string-db.org/network/268739.Nmlp_1980 | Succinate dehydrogenase subunit B; Deleted EC_number 1.3.99.1. |
| sdhA1 protein network | https://string-db.org/network/268739.Nmlp_1981 | Succinate dehydrogenase subunit A; Deleted EC_number 1.3.99.1. |
| Nmlp_1982 protein network | https://string-db.org/network/268739.Nmlp_1982 | Cupin 2 barrel domain protein. |
| thiM protein network | https://string-db.org/network/268739.Nmlp_1983 | Hydroxyethylthiazole kinase; Catalyzes the phosphorylation of the hydroxyl group of 4- methyl-5-beta-hydroxyethylthiazole (THZ); Belongs to the Thz kinase family. |
| thiE protein network | https://string-db.org/network/268739.Nmlp_1984 | Thiamine-phosphate synthase; Condenses 4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate (THZ-P) and 2-methyl-4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-PP) to form thiamine monopho [...] |
| Nmlp_1985 protein network | https://string-db.org/network/268739.Nmlp_1985 | Uncharacterized protein. |
| cysE protein network | https://string-db.org/network/268739.Nmlp_1988 | Serine O-acetyltransferase; Gene has a frameshift and is truncated at both termini; locus_tag: Nmlp_1987; product: DNA N-glycosylase (nonfunctional). |
| Nmlp_1989 protein network | https://string-db.org/network/268739.Nmlp_1989 | Uncharacterized protein. |
| Nmlp_1990 protein network | https://string-db.org/network/268739.Nmlp_1990 | Uncharacterized protein. |
| Nmlp_1991 protein network | https://string-db.org/network/268739.Nmlp_1991 | DUF429 family protein. |
| kef1 protein network | https://string-db.org/network/268739.Nmlp_1992 | Kef-type transport system. |
| mvaD protein network | https://string-db.org/network/268739.Nmlp_1993 | Phosphomevalonate decarboxylase. |
| tatA1 protein network | https://string-db.org/network/268739.Nmlp_1994 | Sec-independent protein translocase subunit TatA; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...] |
| tatA2 protein network | https://string-db.org/network/268739.Nmlp_1995 | Sec-independent protein translocase subunit TatA; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...] |
| Nmlp_1996 protein network | https://string-db.org/network/268739.Nmlp_1996 | Peroxiredoxin. |
| Nmlp_1997 protein network | https://string-db.org/network/268739.Nmlp_1997 | HD family hydrolase. |
| Nmlp_1998 protein network | https://string-db.org/network/268739.Nmlp_1998 | Uncharacterized protein. |
| Nmlp_1999 protein network | https://string-db.org/network/268739.Nmlp_1999 | Receiver box response regulator. |
| Nmlp_2000 protein network | https://string-db.org/network/268739.Nmlp_2000 | Uncharacterized protein. |
| ushA protein network | https://string-db.org/network/268739.Nmlp_2001 | 5'-nucleotidase family hydrolase. |
| Nmlp_2002 protein network | https://string-db.org/network/268739.Nmlp_2002 | UspA domain protein. |
| menD protein network | https://string-db.org/network/268739.Nmlp_2003 | 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylate synthase; Catalyzes the thiamine diphosphate-dependent decarboxylation of 2-oxoglutarate and the subsequent addition of the resulti [...] |
| menF protein network | https://string-db.org/network/268739.Nmlp_2004 | Isochorismate synthase. |
| Nmlp_2005 protein network | https://string-db.org/network/268739.Nmlp_2005 | UPF0058 family protein. |
| Nmlp_2006 protein network | https://string-db.org/network/268739.Nmlp_2006 | Uncharacterized protein. |
| Nmlp_2007 protein network | https://string-db.org/network/268739.Nmlp_2007 | YuiH family molybdopterin-binding domain protein. |
| Nmlp_2008 protein network | https://string-db.org/network/268739.Nmlp_2008 | Receiver box response regulator. |
| ygfD protein network | https://string-db.org/network/268739.Nmlp_2009 | YgfD family GTPase. |
| mmcB protein network | https://string-db.org/network/268739.Nmlp_2010 | methylmalonyl-CoA mutase subunit B (cobalamin-binding subunit). |
| fen1 protein network | https://string-db.org/network/268739.Nmlp_2011 | Flap endonuclease Fen1; Structure-specific nuclease with 5'-flap endonuclease and 5'- 3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-over [...] |
| bolA protein network | https://string-db.org/network/268739.Nmlp_2012 | BolA family protein. |
| fumC protein network | https://string-db.org/network/268739.Nmlp_2013 | Fumarate hydratase; Involved in the TCA cycle. Catalyzes the stereospecific interconversion of fumarate to L-malate; Belongs to the class-II fumarase/aspartase family. Fumarase subfamily. |
| Nmlp_2014 protein network | https://string-db.org/network/268739.Nmlp_2014 | PadR family transcription regulator. |
| gatE protein network | https://string-db.org/network/268739.Nmlp_2015 | glutamyl-tRNA(Gln) amidotransferase subunit E; Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-t [...] |
| speB2 protein network | https://string-db.org/network/268739.Nmlp_2016 | Agmatinase; Belongs to the arginase family. |
| tef5A protein network | https://string-db.org/network/268739.Nmlp_2017 | Translation elongation factor aEF-5A; Functions by promoting the formation of the first peptide bond; Belongs to the eIF-5A family. |
| mch protein network | https://string-db.org/network/268739.Nmlp_2018 | Probable methenyltetrahydrofolate cyclohydrolase; Catalyzes the hydrolysis of methenyl-H(4)MPT(+) to 5-formyl- H(4)MPT. |
| cbs5 protein network | https://string-db.org/network/268739.Nmlp_2019 | CBS domain protein. |
| Nmlp_2020 protein network | https://string-db.org/network/268739.Nmlp_2020 | DMT superfamily transport protein. |
| Nmlp_2021 protein network | https://string-db.org/network/268739.Nmlp_2021 | Uncharacterized protein. |
| Nmlp_2022 protein network | https://string-db.org/network/268739.Nmlp_2022 | Uncharacterized protein. |
| Nmlp_2023 protein network | https://string-db.org/network/268739.Nmlp_2023 | Thioesterase domain protein. |
| Nmlp_2025 protein network | https://string-db.org/network/268739.Nmlp_2025 | Uncharacterized protein. |
| Nmlp_2026 protein network | https://string-db.org/network/268739.Nmlp_2026 | Uncharacterized protein. |
| Nmlp_2027 protein network | https://string-db.org/network/268739.Nmlp_2027 | Small CPxCG-related zinc finger protein. |
| nrdJ1 protein network | https://string-db.org/network/268739.Nmlp_2028 | Ribonucleoside-diphosphate reductase,adenosylcobalamin-dependent (intein-containing); Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from [...] |
| trpG3 protein network | https://string-db.org/network/268739.Nmlp_2029 | Anthranilate synthase component 2. |
| Nmlp_2032 protein network | https://string-db.org/network/268739.Nmlp_2032 | Gene has a frameshift and and lacks a stop codon; locus_tag: Nmlp_2031; product: CBS domain protein (nonfunctional); conceptual translation after in silico reconstruction: MNARDIMTRDVETVSPGDDVGEV [...] |
| Nmlp_2033 protein network | https://string-db.org/network/268739.Nmlp_2033 | Uncharacterized protein. |
| Nmlp_2034 protein network | https://string-db.org/network/268739.Nmlp_2034 | Uncharacterized protein. |
| Nmlp_2035 protein network | https://string-db.org/network/268739.Nmlp_2035 | Thioesterase domain protein. |
| Nmlp_2037 protein network | https://string-db.org/network/268739.Nmlp_2037 | Uncharacterized protein. |
| Nmlp_2038 protein network | https://string-db.org/network/268739.Nmlp_2038 | Uncharacterized protein. |
| trpG1 protein network | https://string-db.org/network/268739.Nmlp_2041 | Gene has frameshifts; locus_tag: Nmlp_2040; product: ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent (intein-containing) (nonfunctional); conceptual translation after in silico [...] |
| trpE1 protein network | https://string-db.org/network/268739.Nmlp_2042 | Anthranilate synthase component 1; Part of a heterotetrameric complex that catalyzes the two- step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first [...] |
| trpF protein network | https://string-db.org/network/268739.Nmlp_2043 | N-(5'-phosphoribosyl)anthranilate isomerase; Belongs to the TrpF family. |
| trpD1 protein network | https://string-db.org/network/268739.Nmlp_2044 | Anthranilate phosphoribosyltransferase; Catalyzes the transfer of the phosphoribosyl group of 5- phosphorylribose-1-pyrophosphate (PRPP) to anthranilate to yield N-(5'- phosphoribosyl)-anthranila [...] |
| Nmlp_2049 protein network | https://string-db.org/network/268739.Nmlp_2049 | HTH domain protein; Product: LpxA family protein (nonfunctional). |
| phoU7 protein network | https://string-db.org/network/268739.Nmlp_2050 | PhoU domain protein. |
| Nmlp_2051 protein network | https://string-db.org/network/268739.Nmlp_2051 | ArsR family transcription regulator; Product: ISH3-type transposase NmIRS94 (nonfunctional). |
| Nmlp_2052 protein network | https://string-db.org/network/268739.Nmlp_2052 | DUF318 family protein. |
| Nmlp_2054 protein network | https://string-db.org/network/268739.Nmlp_2054 | MATE efflux family protein. |
| Nmlp_2055 protein network | https://string-db.org/network/268739.Nmlp_2055 | Oxidoreductase (homolog to zinc-containing alcohol dehydrogenase). |
| hyuA protein network | https://string-db.org/network/268739.Nmlp_2056 | N-methylhydantoinase (ATP-hydrolyzing) A. |
| hyuB protein network | https://string-db.org/network/268739.Nmlp_2057 | N-methylhydantoinase (ATP-hydrolyzing) B. |
| Nmlp_2058 protein network | https://string-db.org/network/268739.Nmlp_2058 | Peroxiredoxin. |
| Nmlp_2059 protein network | https://string-db.org/network/268739.Nmlp_2059 | Uncharacterized protein. |
| Nmlp_2060 protein network | https://string-db.org/network/268739.Nmlp_2060 | Uncharacterized protein. |
| Nmlp_2061 protein network | https://string-db.org/network/268739.Nmlp_2061 | Uncharacterized protein. |
| Nmlp_2062 protein network | https://string-db.org/network/268739.Nmlp_2062 | Uncharacterized protein. |
| Nmlp_2063 protein network | https://string-db.org/network/268739.Nmlp_2063 | Luciferase-type oxidoreductase. |
| Nmlp_2064 protein network | https://string-db.org/network/268739.Nmlp_2064 | Uncharacterized protein. |
| Nmlp_2065 protein network | https://string-db.org/network/268739.Nmlp_2065 | Uncharacterized protein. |
| Nmlp_2066 protein network | https://string-db.org/network/268739.Nmlp_2066 | Uncharacterized protein. |
| Nmlp_2067 protein network | https://string-db.org/network/268739.Nmlp_2067 | Lrp/AsnC family transcription regulator. |
| Nmlp_2068 protein network | https://string-db.org/network/268739.Nmlp_2068 | Uncharacterized protein. |
| Nmlp_2069 protein network | https://string-db.org/network/268739.Nmlp_2069 | FAD dependent oxidoreductase. |
| mce protein network | https://string-db.org/network/268739.Nmlp_2070 | methylmalonyl-CoA epimerase. |
| mmcA2 protein network | https://string-db.org/network/268739.Nmlp_2071 | methylmalonyl-CoA mutase subunit A. |
| pcrB protein network | https://string-db.org/network/268739.Nmlp_2072 | (S)-3-O-geranylgeranylglyceryl phosphate synthase 1; Prenyltransferase that catalyzes the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glyce [...] |
| topA protein network | https://string-db.org/network/268739.Nmlp_2073 | DNA topoisomerase 1; Releases the supercoiling and torsional tension of DNA, which is introduced during the DNA replication and transcription, by transiently cleaving and rejoining one strand of [...] |
| gatB protein network | https://string-db.org/network/268739.Nmlp_2074 | aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu [...] |
| Nmlp_2076 protein network | https://string-db.org/network/268739.Nmlp_2076 | Beta-lactamase domain protein. |
| pepB3 protein network | https://string-db.org/network/268739.Nmlp_2077 | Aminopeptidase (homolog to leucyl aminopeptidase. |
| cbs3 protein network | https://string-db.org/network/268739.Nmlp_2078 | CBS domain protein. |
| Nmlp_2079 protein network | https://string-db.org/network/268739.Nmlp_2079 | HTH domain protein. |
| nirA2 protein network | https://string-db.org/network/268739.Nmlp_2080 | Probable sulfite/nitrite reductase (ferredoxin). |
| Nmlp_2081 protein network | https://string-db.org/network/268739.Nmlp_2081 | Uncharacterized protein. |
| Nmlp_2082 protein network | https://string-db.org/network/268739.Nmlp_2082 | Uncharacterized protein. |
| Nmlp_2083 protein network | https://string-db.org/network/268739.Nmlp_2083 | Uncharacterized protein. |
| mmsA protein network | https://string-db.org/network/268739.Nmlp_2084 | Methylmalonate-semialdehyde dehydrogenase. |
| htr40 protein network | https://string-db.org/network/268739.Nmlp_2085 | Transducer protein Htr40. |
| Nmlp_2086 protein network | https://string-db.org/network/268739.Nmlp_2086 | Probable S-adenosylmethionine-dependent methyltransferase. |
| Nmlp_2087 protein network | https://string-db.org/network/268739.Nmlp_2087 | Polyamine aminopropyltransferase. |
| cbs12 protein network | https://string-db.org/network/268739.Nmlp_2088 | DUF21/CBS domain protein. |
| Nmlp_2089 protein network | https://string-db.org/network/268739.Nmlp_2089 | SCO1/SenC/PrrC family protein. |
| trxA6 protein network | https://string-db.org/network/268739.Nmlp_2090 | Thioredoxin. |
| Nmlp_2091 protein network | https://string-db.org/network/268739.Nmlp_2091 | Homolog to cytochrome c-type biogenesis protein CcdA. |
| cat3 protein network | https://string-db.org/network/268739.Nmlp_2092 | Transport protein (probable substrate cationic amino acids). |
| Nmlp_2093 protein network | https://string-db.org/network/268739.Nmlp_2093 | UspA domain protein. |
| map protein network | https://string-db.org/network/268739.Nmlp_2094 | Methionine aminopeptidase; Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharg [...] |
| Nmlp_2095 protein network | https://string-db.org/network/268739.Nmlp_2095 | DUF63 family protein. |
| udp2 protein network | https://string-db.org/network/268739.Nmlp_2096 | Uridine phosphorylase. |
| pchA1 protein network | https://string-db.org/network/268739.Nmlp_2097 | Ion channel pore / TrkA domain protein. |
| Nmlp_2098 protein network | https://string-db.org/network/268739.Nmlp_2098 | TrkA-C domain protein. |
| Nmlp_2099 protein network | https://string-db.org/network/268739.Nmlp_2099 | TrkA-C domain protein. |
| Nmlp_2100 protein network | https://string-db.org/network/268739.Nmlp_2100 | Uncharacterized protein. |
| ddh protein network | https://string-db.org/network/268739.Nmlp_2102 | D-2-hydroxyacid dehydrogenase (NADP); Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. |
| apt1 protein network | https://string-db.org/network/268739.Nmlp_2103 | HGPRTase-like protein; May catalyze a purine salvage reaction, the substrate is unknown. |
| Nmlp_2104 protein network | https://string-db.org/network/268739.Nmlp_2104 | Uncharacterized protein. |
| Nmlp_2105 protein network | https://string-db.org/network/268739.Nmlp_2105 | UspA domain protein. |
| Nmlp_2106 protein network | https://string-db.org/network/268739.Nmlp_2106 | UspA domain protein. |
| Nmlp_2107 protein network | https://string-db.org/network/268739.Nmlp_2107 | GNAT family acetyltransferase. |
| Nmlp_2108 protein network | https://string-db.org/network/268739.Nmlp_2108 | UspA domain protein. |
| Nmlp_2109 protein network | https://string-db.org/network/268739.Nmlp_2109 | Uncharacterized protein. |
| pyrC protein network | https://string-db.org/network/268739.Nmlp_2110 | Dihydroorotase; Catalyzes the reversible cyclization of carbamoyl aspartate to dihydroorotate; Belongs to the metallo-dependent hydrolases superfamily. DHOase family. Class I DHOase subfamily. |
| Nmlp_2111 protein network | https://string-db.org/network/268739.Nmlp_2111 | Peptidase M23 family protein. |
| Nmlp_2112 protein network | https://string-db.org/network/268739.Nmlp_2112 | Probable 16S rRNA maturation protein; Probable pre-rRNA processing protein involved in ribosome biogenesis; Belongs to the TSR3 family. |
| Nmlp_2113 protein network | https://string-db.org/network/268739.Nmlp_2113 | DUF1486 family protein. |
| serS protein network | https://string-db.org/network/268739.Nmlp_2114 | serine--tRNA ligase; Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L- seryl-tRNA(Sec), which will be further co [...] |
| Nmlp_2115 protein network | https://string-db.org/network/268739.Nmlp_2115 | Beta-lactamase domain protein. |
| arsA3 protein network | https://string-db.org/network/268739.Nmlp_2116 | ArsA family ATPase. |
| Nmlp_2117 protein network | https://string-db.org/network/268739.Nmlp_2117 | Uncharacterized protein. |
| Nmlp_2118 protein network | https://string-db.org/network/268739.Nmlp_2118 | CobW domain protein. |
| Nmlp_2121 protein network | https://string-db.org/network/268739.Nmlp_2121 | Product: uncharacterized protein (nonfunctional). |
| Nmlp_2122 protein network | https://string-db.org/network/268739.Nmlp_2122 | Uncharacterized protein. |
| Nmlp_2125 protein network | https://string-db.org/network/268739.Nmlp_2125 | Uncharacterized protein. |
| Nmlp_2126 protein network | https://string-db.org/network/268739.Nmlp_2126 | Uncharacterized protein. |
| cstA protein network | https://string-db.org/network/268739.Nmlp_2127 | Carbon starvation protein CstA. |
| Nmlp_2128 protein network | https://string-db.org/network/268739.Nmlp_2128 | DUF83 domain protein. |
| yrdC protein network | https://string-db.org/network/268739.Nmlp_2129 | threonylcarbamoyl-AMP synthase YrdC. |
| Nmlp_2130 protein network | https://string-db.org/network/268739.Nmlp_2130 | Peroxiredoxin domain protein. |
| grx2 protein network | https://string-db.org/network/268739.Nmlp_2131 | Glutaredoxin. |
| cbs9 protein network | https://string-db.org/network/268739.Nmlp_2132 | DUF21/CBS domain protein. |
| Nmlp_2133 protein network | https://string-db.org/network/268739.Nmlp_2133 | Transport protein (probable substrate phosphate/sulfate). |
| Nmlp_2134 protein network | https://string-db.org/network/268739.Nmlp_2134 | IMPACT family protein. |
| upp protein network | https://string-db.org/network/268739.Nmlp_2135 | Uracil phosphoribosyltransferase; Catalyzes the conversion of uracil and 5-phospho-alpha-D- ribose 1-diphosphate (PRPP) to UMP and diphosphate. |
| Nmlp_2136 protein network | https://string-db.org/network/268739.Nmlp_2136 | Uncharacterized protein. |
| Nmlp_2137 protein network | https://string-db.org/network/268739.Nmlp_2137 | ACT domain protein. |
| Nmlp_2138 protein network | https://string-db.org/network/268739.Nmlp_2138 | PaaI family protein. |
| mobB protein network | https://string-db.org/network/268739.Nmlp_2139 | Molybdopterin-guanine dinucleotide biosynthesis adapter protein MobB. |
| maoC3 protein network | https://string-db.org/network/268739.Nmlp_2140 | MaoC domain protein. |
| Nmlp_2141 protein network | https://string-db.org/network/268739.Nmlp_2141 | Uncharacterized protein. |
| Nmlp_2142 protein network | https://string-db.org/network/268739.Nmlp_2142 | Uncharacterized protein. |
| Nmlp_2143 protein network | https://string-db.org/network/268739.Nmlp_2143 | Uncharacterized protein. |
| Nmlp_2144 protein network | https://string-db.org/network/268739.Nmlp_2144 | Uncharacterized protein. |
| Nmlp_2145 protein network | https://string-db.org/network/268739.Nmlp_2145 | PRC domain protein. |
| nob1 protein network | https://string-db.org/network/268739.Nmlp_2146 | rRNA maturation endonuclease Nob1. |
| Nmlp_2147 protein network | https://string-db.org/network/268739.Nmlp_2147 | Abi/CAAX domain protein. |
| pgi protein network | https://string-db.org/network/268739.Nmlp_2148 | Glucose-6-phosphate isomerase; Belongs to the GPI family. |
| Nmlp_2149 protein network | https://string-db.org/network/268739.Nmlp_2149 | Uncharacterized protein. |
| Nmlp_2150 protein network | https://string-db.org/network/268739.Nmlp_2150 | Uncharacterized protein. |
| rps15 protein network | https://string-db.org/network/268739.Nmlp_2151 | 30S ribosomal protein S15. |
| recJ2 protein network | https://string-db.org/network/268739.Nmlp_2152 | Probable replication complex protein RecJ2. |
| Nmlp_2153 protein network | https://string-db.org/network/268739.Nmlp_2153 | Uncharacterized protein. |
| rps1e protein network | https://string-db.org/network/268739.Nmlp_2154 | 30S ribosomal protein S1e; Belongs to the eukaryotic ribosomal protein eS1 family. |
| tmk protein network | https://string-db.org/network/268739.Nmlp_2155 | Thymidylate kinase. |
| Nmlp_2156 protein network | https://string-db.org/network/268739.Nmlp_2156 | Lrp/AsnC family transcription regulator. |
| trkA2 protein network | https://string-db.org/network/268739.Nmlp_2157 | TrkA domain protein. |
| Nmlp_2158 protein network | https://string-db.org/network/268739.Nmlp_2158 | Lrp/AsnC family transcription regulator. |
| cspA3 protein network | https://string-db.org/network/268739.Nmlp_2160 | Cold shock protein. |
| tfbA1 protein network | https://string-db.org/network/268739.Nmlp_2161 | Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB). |
| gabD protein network | https://string-db.org/network/268739.Nmlp_2162 | Succinate-semialdehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family. |
| Nmlp_2163 protein network | https://string-db.org/network/268739.Nmlp_2163 | Lrp/AsnC family transcription regulator. |
| carA protein network | https://string-db.org/network/268739.Nmlp_2164 | Carbamoyl-phosphate synthase (glutamine-hydrolyzing) small subunit; Belongs to the CarA family. |
| sopI protein network | https://string-db.org/network/268739.Nmlp_2165 | Sensory rhodopsin I. |
| htr1S protein network | https://string-db.org/network/268739.Nmlp_2166 | Sensory rhodopsin I transducer signalling region. |
| Nmlp_2167 protein network | https://string-db.org/network/268739.Nmlp_2167 | Integrase family protein. |
| Nmlp_2168 protein network | https://string-db.org/network/268739.Nmlp_2168 | Uncharacterized protein. |
| Nmlp_2169 protein network | https://string-db.org/network/268739.Nmlp_2169 | Uncharacterized protein. |
| Nmlp_2170 protein network | https://string-db.org/network/268739.Nmlp_2170 | Uncharacterized protein. |
| Nmlp_2171 protein network | https://string-db.org/network/268739.Nmlp_2171 | Uncharacterized protein. |
| Nmlp_2172 protein network | https://string-db.org/network/268739.Nmlp_2172 | Uncharacterized protein. |
| Nmlp_2173 protein network | https://string-db.org/network/268739.Nmlp_2173 | Uncharacterized protein. |
| Nmlp_2174 protein network | https://string-db.org/network/268739.Nmlp_2174 | Uncharacterized protein. |
| Nmlp_2175 protein network | https://string-db.org/network/268739.Nmlp_2175 | ISHwa16-type transposase ISNamo16. |
| Nmlp_2178 protein network | https://string-db.org/network/268739.Nmlp_2178 | Site-specific DNA-methyltransferase (cytosine-specific). |
| Nmlp_2180 protein network | https://string-db.org/network/268739.Nmlp_2180 | Site-specific DNA-methyltransferase (Cytosine-specific); Gene has an in-frame stop codon; locus_tag: Nmlp_2179; product: ISH14-type transposase ISNamo8 (nonfunctional); conceptual translation aft [...] |
| Nmlp_2181 protein network | https://string-db.org/network/268739.Nmlp_2181 | Uncharacterized protein. |
| Nmlp_2182 protein network | https://string-db.org/network/268739.Nmlp_2182 | Uncharacterized protein. |
| Nmlp_2184 protein network | https://string-db.org/network/268739.Nmlp_2184 | Uncharacterized protein. |
| Nmlp_2185 protein network | https://string-db.org/network/268739.Nmlp_2185 | Uncharacterized protein. |
| Nmlp_2186 protein network | https://string-db.org/network/268739.Nmlp_2186 | PLD domain protein. |
| Nmlp_2187 protein network | https://string-db.org/network/268739.Nmlp_2187 | Uncharacterized protein. |
| Nmlp_2188 protein network | https://string-db.org/network/268739.Nmlp_2188 | Helicase domain protein. |
| Nmlp_2189 protein network | https://string-db.org/network/268739.Nmlp_2189 | Uncharacterized protein. |
| Nmlp_2191 protein network | https://string-db.org/network/268739.Nmlp_2191 | DUF192 family protein. |
| Nmlp_2192 protein network | https://string-db.org/network/268739.Nmlp_2192 | ABC-type transport system ATP-binding/permease protein. |
| Nmlp_2193 protein network | https://string-db.org/network/268739.Nmlp_2193 | ATP-grasp fold protein. |
| Nmlp_2194 protein network | https://string-db.org/network/268739.Nmlp_2194 | Uncharacterized protein. |
| Nmlp_2195 protein network | https://string-db.org/network/268739.Nmlp_2195 | Uncharacterized protein. |
| nolA2 protein network | https://string-db.org/network/268739.Nmlp_2196 | arNOG08307 family NADH-binding domain protein. |
| Nmlp_2197 protein network | https://string-db.org/network/268739.Nmlp_2197 | Histidine kinase. |
| Nmlp_2198 protein network | https://string-db.org/network/268739.Nmlp_2198 | DUF418 domain protein. |
| trkA3 protein network | https://string-db.org/network/268739.Nmlp_2199 | TrkA domain protein. |
| cat4 protein network | https://string-db.org/network/268739.Nmlp_2200 | Transport protein (probable substrate cationic amino acids). |
| fxsA protein network | https://string-db.org/network/268739.Nmlp_2201 | FxsA domain protein. |
| gpmI protein network | https://string-db.org/network/268739.Nmlp_2202 | Phosphoglycerate mutase,2,3-biphosphateglycerate-independent type; Catalyzes the interconversion of 2-phosphoglycerate and 3- phosphoglycerate; Belongs to the BPG-independent phosphoglycerate mut [...] |
| Nmlp_2203 protein network | https://string-db.org/network/268739.Nmlp_2203 | Alpha/beta hydrolase fold protein. |
| zim protein network | https://string-db.org/network/268739.Nmlp_2205 | CTAG modification methylase. |
| Nmlp_2206 protein network | https://string-db.org/network/268739.Nmlp_2206 | Uncharacterized protein; Product: IS200-type transposase NmIRS33 (nonfunctional). |
| fadA2 protein network | https://string-db.org/network/268739.Nmlp_2207 | enoyl-CoA hydratase; Belongs to the enoyl-CoA hydratase/isomerase family. |
| nadE protein network | https://string-db.org/network/268739.Nmlp_2208 | NAD synthase, ammonia-dependent; Catalyzes the ATP-dependent amidation of deamido-NAD to form NAD. Uses ammonia as a nitrogen source. |
| serA3 protein network | https://string-db.org/network/268739.Nmlp_2209 | Probable D-2-hydroxyacid dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. |
| Nmlp_2210 protein network | https://string-db.org/network/268739.Nmlp_2210 | UPF0047 family protein. |
| arfC protein network | https://string-db.org/network/268739.Nmlp_2212 | 2,5-diamino-6-(Ribosylamino)-4(3H)-pyrimidinone 5'-phosphate reductase; Gene has a frameshift and is truncated at the N-terminus; locus_tag: Nmlp_2211; product: poly(3-hydroxybutyrate) depolymera [...] |
| Nmlp_2213 protein network | https://string-db.org/network/268739.Nmlp_2213 | tRNA (cytidine/uridine-2'-O-)-methyltransferase. |
| Nmlp_2215 protein network | https://string-db.org/network/268739.Nmlp_2215 | Uncharacterized protein. |
| Nmlp_2217 protein network | https://string-db.org/network/268739.Nmlp_2217 | Alpha/beta hydrolase fold protein. |
| folP2 protein network | https://string-db.org/network/268739.Nmlp_2218 | Dihydropteroate synthase. |
| mptE protein network | https://string-db.org/network/268739.Nmlp_2219 | 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase MptE; Catalyzes the transfer of diphosphate from ATP to 6- hydroxymethyl-7,8-dihydropterin (6-HMD), leading to 6-hydroxymethyl- 7,8-dihydropter [...] |
| Nmlp_2220 protein network | https://string-db.org/network/268739.Nmlp_2220 | Probable S-adenosylmethionine-dependent methyltransferase. |
| trkA4 protein network | https://string-db.org/network/268739.Nmlp_2221 | TrkA domain protein. |
| Nmlp_2222 protein network | https://string-db.org/network/268739.Nmlp_2222 | Uncharacterized protein. |
| Nmlp_2223 protein network | https://string-db.org/network/268739.Nmlp_2223 | PDCD5 family DNA-binding protein; Belongs to the PDCD5 family. |
| serA2 protein network | https://string-db.org/network/268739.Nmlp_2224 | Probable D-2-hydroxyacid dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. |
| Nmlp_2225 protein network | https://string-db.org/network/268739.Nmlp_2225 | UspA domain protein. |
| Nmlp_2226 protein network | https://string-db.org/network/268739.Nmlp_2226 | Major facilitator superfamily transport protein. |
| hisD protein network | https://string-db.org/network/268739.Nmlp_2227 | Histidinol dehydrogenase; Catalyzes the sequential NAD-dependent oxidations of L- histidinol to L-histidinaldehyde and then to L-histidine. |
| sirR protein network | https://string-db.org/network/268739.Nmlp_2228 | SirR/DtxR family transcription regulator SirR. |
| Nmlp_2229 protein network | https://string-db.org/network/268739.Nmlp_2229 | MTH865 family protein. |
| Nmlp_2230 protein network | https://string-db.org/network/268739.Nmlp_2230 | Uncharacterized protein. |
| Nmlp_2231 protein network | https://string-db.org/network/268739.Nmlp_2231 | Uncharacterized protein. |
| Nmlp_2232 protein network | https://string-db.org/network/268739.Nmlp_2232 | DUF2062 family protein. |
| Nmlp_2233 protein network | https://string-db.org/network/268739.Nmlp_2233 | Uncharacterized protein. |
| Nmlp_2234 protein network | https://string-db.org/network/268739.Nmlp_2234 | Sensor box histidine kinase. |
| Nmlp_2235 protein network | https://string-db.org/network/268739.Nmlp_2235 | Beta-lactamase domain protein. |
| Nmlp_2236 protein network | https://string-db.org/network/268739.Nmlp_2236 | Major facilitator superfamily transport protein. |
| Nmlp_2237 protein network | https://string-db.org/network/268739.Nmlp_2237 | Uncharacterized protein. |
| Nmlp_2238 protein network | https://string-db.org/network/268739.Nmlp_2238 | Lrp/AsnC family transcription regulator. |
| aspC1 protein network | https://string-db.org/network/268739.Nmlp_2239 | Pyridoxal phosphate-dependent aminotransferase. |
| Nmlp_2240 protein network | https://string-db.org/network/268739.Nmlp_2240 | Type IV pilus biogenesis complex ATPase subunit. |
| Nmlp_2241 protein network | https://string-db.org/network/268739.Nmlp_2241 | Type IV pilus biogenesis complex membrane subunit. |
| Nmlp_2242 protein network | https://string-db.org/network/268739.Nmlp_2242 | Uncharacterized protein. |
| Nmlp_2243 protein network | https://string-db.org/network/268739.Nmlp_2243 | Uncharacterized protein. |
| Nmlp_2244 protein network | https://string-db.org/network/268739.Nmlp_2244 | Uncharacterized protein. |
| Nmlp_2245 protein network | https://string-db.org/network/268739.Nmlp_2245 | Probable secreted glycoprotein. |
| Nmlp_2246 protein network | https://string-db.org/network/268739.Nmlp_2246 | Probable secreted glycoprotein. |
| Nmlp_2247 protein network | https://string-db.org/network/268739.Nmlp_2247 | Probable secreted glycoprotein. |
| Nmlp_2249 protein network | https://string-db.org/network/268739.Nmlp_2249 | Uncharacterized protein. |
| Nmlp_2250 protein network | https://string-db.org/network/268739.Nmlp_2250 | Uncharacterized protein. |
| Nmlp_2251 protein network | https://string-db.org/network/268739.Nmlp_2251 | UspA domain protein. |
| Nmlp_2252 protein network | https://string-db.org/network/268739.Nmlp_2252 | GNAT family acetyltransferase. |
| Nmlp_2253 protein network | https://string-db.org/network/268739.Nmlp_2253 | Probable S-adenosylmethionine-dependent methyltransferase. |
| Nmlp_2254 protein network | https://string-db.org/network/268739.Nmlp_2254 | DUF3054 family protein. |
| Nmlp_2255 protein network | https://string-db.org/network/268739.Nmlp_2255 | Major facilitator superfamily transport protein. |
| aroC protein network | https://string-db.org/network/268739.Nmlp_2256 | Chorismate synthase; Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch poin [...] |
| guaB2 protein network | https://string-db.org/network/268739.Nmlp_2257 | Inosine-5'-monophosphate dehydrogenase. |
| aroA protein network | https://string-db.org/network/268739.Nmlp_2258 | 3-phosphoshikimate 1-carboxyvinyltransferase; Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl [...] |
| Nmlp_2259 protein network | https://string-db.org/network/268739.Nmlp_2259 | Peptidase M24 family protein (homolog to Xaa-Pro dipeptidase). |
| tyrA protein network | https://string-db.org/network/268739.Nmlp_2260 | Prephenate dehydrogenase. |
| Nmlp_2261 protein network | https://string-db.org/network/268739.Nmlp_2261 | Probable S-adenosylmethionine-dependent methyltransferase. |
| Nmlp_2262 protein network | https://string-db.org/network/268739.Nmlp_2262 | Uncharacterized protein. |
| Nmlp_2263 protein network | https://string-db.org/network/268739.Nmlp_2263 | CopG domain protein. |
| Nmlp_2264 protein network | https://string-db.org/network/268739.Nmlp_2264 | Uncharacterized protein. |
| aglJ protein network | https://string-db.org/network/268739.Nmlp_2265 | Dolichyl-phosphate hexosyltransferase AglJ. |
| coaD protein network | https://string-db.org/network/268739.Nmlp_2266 | Phosphopantetheine adenylyltransferase. |
| Nmlp_2267 protein network | https://string-db.org/network/268739.Nmlp_2267 | TrmB family transcription regulator. |
| Nmlp_2268 protein network | https://string-db.org/network/268739.Nmlp_2268 | RND superfamily permease. |
| Nmlp_2269 protein network | https://string-db.org/network/268739.Nmlp_2269 | Uncharacterized protein. |
| Nmlp_2270 protein network | https://string-db.org/network/268739.Nmlp_2270 | TetR family transcription regulator. |
| gshA protein network | https://string-db.org/network/268739.Nmlp_2271 | Glutamate--cysteine ligase; Catalyzes the synthesis of gamma-glutamylcysteine (gamma-GC), the main low-molecular-weight thiol compound instead of glutathione in halophilic archaea; Belongs to the [...] |
| fib protein network | https://string-db.org/network/268739.Nmlp_2273 | Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase; Involved in pre-rRNA and tRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylatio [...] |
| nop5 protein network | https://string-db.org/network/268739.Nmlp_2274 | rRNA/tRNA 2'-O-methyltransferase complex protein Nop5. |
| Nmlp_2275 protein network | https://string-db.org/network/268739.Nmlp_2275 | Homolog to autoinducer-2-degrading protein lsrG. |
| acd2 protein network | https://string-db.org/network/268739.Nmlp_2276 | acyl-CoA dehydrogenase. |
| Nmlp_2277 protein network | https://string-db.org/network/268739.Nmlp_2277 | Receiver/sensor box histidine kinase. |
| Nmlp_2278 protein network | https://string-db.org/network/268739.Nmlp_2278 | Receiver box histidine kinase. |
| Nmlp_2279 protein network | https://string-db.org/network/268739.Nmlp_2279 | Receiver box response regulator. |
| mcm protein network | https://string-db.org/network/268739.Nmlp_2280 | ATP-dependent DNA helicase MCM (intein-containing). |
| Nmlp_2281 protein network | https://string-db.org/network/268739.Nmlp_2281 | Uncharacterized protein. |
| Nmlp_2282 protein network | https://string-db.org/network/268739.Nmlp_2282 | Uncharacterized protein. |
| Nmlp_2283 protein network | https://string-db.org/network/268739.Nmlp_2283 | Uncharacterized protein. |
| Nmlp_2284 protein network | https://string-db.org/network/268739.Nmlp_2284 | Uncharacterized protein. |
| Nmlp_2288 protein network | https://string-db.org/network/268739.Nmlp_2288 | Probable secreted glycoprotein. |
| Nmlp_2289 protein network | https://string-db.org/network/268739.Nmlp_2289 | Uncharacterized protein. |
| Nmlp_2290 protein network | https://string-db.org/network/268739.Nmlp_2290 | CopD domain protein. |
| lpdA1 protein network | https://string-db.org/network/268739.Nmlp_2291 | Dihydrolipoyl dehydrogenase. |
| aspC5 protein network | https://string-db.org/network/268739.Nmlp_2292 | Pyridoxal phosphate-dependent aminotransferase. |
| Nmlp_2293 protein network | https://string-db.org/network/268739.Nmlp_2293 | Small CPxCG-related zinc finger protein. |
| Nmlp_2294 protein network | https://string-db.org/network/268739.Nmlp_2294 | Homolog to carboxylate-amine ligase. |
| guaAa2 protein network | https://string-db.org/network/268739.Nmlp_2295 | Glutamine amidotransferase (homolog to GMP synthase subunit A). |
| Nmlp_2296 protein network | https://string-db.org/network/268739.Nmlp_2296 | Homolog to translation elongation factor aEF-1 alpha subunit. |
| Nmlp_2297 protein network | https://string-db.org/network/268739.Nmlp_2297 | Phosphoglycolate phosphatase; Catalyzes the dephosphorylation of 2-phosphoglycolate. |
| Nmlp_2298 protein network | https://string-db.org/network/268739.Nmlp_2298 | Uncharacterized protein. |
| tif1A2 protein network | https://string-db.org/network/268739.Nmlp_2300 | Translation initiation factor aIF-1A; Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-t [...] |
| Nmlp_2301 protein network | https://string-db.org/network/268739.Nmlp_2301 | GTP-binding protein. |
| cyc1 protein network | https://string-db.org/network/268739.Nmlp_2302 | Cytochrome P450. |
| oxdhA2 protein network | https://string-db.org/network/268739.Nmlp_2303 | Probable 2-oxoacid dehydrogenase E1 component alpha subunit. |
| Nmlp_2304 protein network | https://string-db.org/network/268739.Nmlp_2304 | Uncharacterized protein. |
| elp3 protein network | https://string-db.org/network/268739.Nmlp_2305 | Homolog to elongator complex protein ELP3. |
| Nmlp_2306 protein network | https://string-db.org/network/268739.Nmlp_2306 | DHH/RecJ family phosphoesterase. |
| Nmlp_2307 protein network | https://string-db.org/network/268739.Nmlp_2307 | Homolog to NAD(P)H dehydrogenase (quinone). |
| Nmlp_2308 protein network | https://string-db.org/network/268739.Nmlp_2308 | GalE family epimerase/dehydratase. |
| mutY protein network | https://string-db.org/network/268739.Nmlp_2309 | A/G-specific adenine glycosylase. |
| tenA2 protein network | https://string-db.org/network/268739.Nmlp_2310 | Aminopyrimidine aminohydrolase. |
| Nmlp_2311 protein network | https://string-db.org/network/268739.Nmlp_2311 | Gdt1 family protein. |
| Nmlp_2312 protein network | https://string-db.org/network/268739.Nmlp_2312 | Uncharacterized protein. |
| Nmlp_2313 protein network | https://string-db.org/network/268739.Nmlp_2313 | ArsR family transcription regulator. |
| nosL3 protein network | https://string-db.org/network/268739.Nmlp_2314 | NosL family protein. |
| nosY2 protein network | https://string-db.org/network/268739.Nmlp_2315 | ABC-type transport system permease protein (probable substrate copper). |
| nosF2 protein network | https://string-db.org/network/268739.Nmlp_2316 | ABC-type transport system ATP-binding protein (probable substrate copper). |
| nosD2 protein network | https://string-db.org/network/268739.Nmlp_2317 | ABC-type transport system periplasmic substrate-binding protein (probable substrate copper). |
| nosY1 protein network | https://string-db.org/network/268739.Nmlp_2318 | ABC-type transport system permease protein (probable substrate copper). |
| nosF1 protein network | https://string-db.org/network/268739.Nmlp_2319 | ABC-type transport system ATP-binding protein (probable substrate copper). |
| nosD1 protein network | https://string-db.org/network/268739.Nmlp_2320 | ABC-type transport system periplasmic substrate-binding protein (probable substrate copper). |
| Nmlp_2321 protein network | https://string-db.org/network/268739.Nmlp_2321 | TRAM domain protein. |
| Nmlp_2322 protein network | https://string-db.org/network/268739.Nmlp_2322 | Transport protein (probable substrate phosphate/sulfate). |
| Nmlp_2323 protein network | https://string-db.org/network/268739.Nmlp_2323 | Glutamate/valine-rich protein. |
| Nmlp_2324 protein network | https://string-db.org/network/268739.Nmlp_2324 | UspA domain protein. |
| Nmlp_2325 protein network | https://string-db.org/network/268739.Nmlp_2325 | Metallophosphoesterase domain protein. |
| psd protein network | https://string-db.org/network/268739.Nmlp_2326 | Probable archaetidylserine decarboxylase. |
| Nmlp_2327 protein network | https://string-db.org/network/268739.Nmlp_2327 | Uncharacterized protein. |
| Nmlp_2328 protein network | https://string-db.org/network/268739.Nmlp_2328 | Uncharacterized protein. |
| Nmlp_2329 protein network | https://string-db.org/network/268739.Nmlp_2329 | Small CPxCG-related zinc finger protein. |
| cdc48c protein network | https://string-db.org/network/268739.Nmlp_2330 | AAA-type ATPase (CDC48 subfamily). |
| Nmlp_2331 protein network | https://string-db.org/network/268739.Nmlp_2331 | Sensor box histidine kinase. |
| Nmlp_2332 protein network | https://string-db.org/network/268739.Nmlp_2332 | Peptidase M20 family protein (homolog to succinyl-diaminopimelate desuccinylase). |
| trxA2 protein network | https://string-db.org/network/268739.Nmlp_2333 | Thioredoxin. |
| Nmlp_2334 protein network | https://string-db.org/network/268739.Nmlp_2334 | FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase). |
| Nmlp_2335 protein network | https://string-db.org/network/268739.Nmlp_2335 | Probable oxidoreductase (aldo-keto reductase family protein). |
| Nmlp_2336 protein network | https://string-db.org/network/268739.Nmlp_2336 | Uncharacterized protein. |
| Nmlp_2337 protein network | https://string-db.org/network/268739.Nmlp_2337 | Peptidase M42 family protein. |
| nadK2 protein network | https://string-db.org/network/268739.Nmlp_2338 | Probable NAD kinase (polyphosphate/ATP). |
| Nmlp_2339 protein network | https://string-db.org/network/268739.Nmlp_2339 | Receiver/sensor box histidine kinase. |
| Nmlp_2340 protein network | https://string-db.org/network/268739.Nmlp_2340 | Uncharacterized protein. |
| uppS1 protein network | https://string-db.org/network/268739.Nmlp_2341 | Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific); Catalyzes the sequential condensation of isopentenyl diphosphate (IPP) with geranylgeranyl diphosphate (G [...] |
| Nmlp_2342 protein network | https://string-db.org/network/268739.Nmlp_2342 | UPF0104 family protein. |
| uppS2 protein network | https://string-db.org/network/268739.Nmlp_2343 | Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific). |
| Nmlp_2344 protein network | https://string-db.org/network/268739.Nmlp_2344 | DUF92 family protein. |
| Nmlp_2345 protein network | https://string-db.org/network/268739.Nmlp_2345 | GNAT family acetyltransferase. |
| dnaG protein network | https://string-db.org/network/268739.Nmlp_2346 | DNA primase DnaG; RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication. |
| pspA1 protein network | https://string-db.org/network/268739.Nmlp_2347 | PspA domain protein. |
| Nmlp_2348 protein network | https://string-db.org/network/268739.Nmlp_2348 | Uncharacterized protein. |
| rpl42e protein network | https://string-db.org/network/268739.Nmlp_2349 | 50S ribosomal protein L42e; Binds to the 23S rRNA. |
| rps27e protein network | https://string-db.org/network/268739.Nmlp_2350 | 30S ribosomal protein S27e. |
| tif2a protein network | https://string-db.org/network/268739.Nmlp_2351 | Translation initiation factor aIF-2 alpha subunit. |
| nop10 protein network | https://string-db.org/network/268739.Nmlp_2352 | tRNA/rRNA pseudouridine synthase complex protein Nop10. |
| Nmlp_2353 protein network | https://string-db.org/network/268739.Nmlp_2353 | PAC2 family protein. |
| Nmlp_2354 protein network | https://string-db.org/network/268739.Nmlp_2354 | Uncharacterized protein. |
| dapD protein network | https://string-db.org/network/268739.Nmlp_2355 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. |
| aceA protein network | https://string-db.org/network/268739.Nmlp_2356 | Isocitrate lyase. |
| aceB protein network | https://string-db.org/network/268739.Nmlp_2357 | Malate synthase. |
| ham1 protein network | https://string-db.org/network/268739.Nmlp_2358 | Non-canonical purine NTP pyrophosphatase. |
| Nmlp_2359 protein network | https://string-db.org/network/268739.Nmlp_2359 | Uncharacterized protein. |
| Nmlp_2361 protein network | https://string-db.org/network/268739.Nmlp_2361 | Sulfate permease family protein. |
| Nmlp_2362 protein network | https://string-db.org/network/268739.Nmlp_2362 | Cyclin domain protein. |
| aglB protein network | https://string-db.org/network/268739.Nmlp_2363 | Dolichyl-monophosphooligosaccharide--protein glycotransferase AglB. |
| Nmlp_2364 protein network | https://string-db.org/network/268739.Nmlp_2364 | DUF368 family protein. |
| Nmlp_2365 protein network | https://string-db.org/network/268739.Nmlp_2365 | Probable rhomboid family protease. |
| rnp3 protein network | https://string-db.org/network/268739.Nmlp_2366 | Ribonuclease P protein component 3; Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends; Belongs to the eukaryotic/archaeal RNase P protein co [...] |
| Nmlp_2367 protein network | https://string-db.org/network/268739.Nmlp_2367 | Uncharacterized protein. |
| Nmlp_2368 protein network | https://string-db.org/network/268739.Nmlp_2368 | Uncharacterized protein. |
| Nmlp_2369 protein network | https://string-db.org/network/268739.Nmlp_2369 | Uncharacterized protein. |
| rnp2 protein network | https://string-db.org/network/268739.Nmlp_2370 | Ribonuclease P protein component 2; Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends; Belongs to the eukaryotic/archaeal RNase P protein co [...] |
| psmA protein network | https://string-db.org/network/268739.Nmlp_2371 | Proteasome alpha subunit; Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. |
| Nmlp_2372 protein network | https://string-db.org/network/268739.Nmlp_2372 | SBDS family protein. |
| qor2 protein network | https://string-db.org/network/268739.Nmlp_2373 | NADPH:quinone reductase. |
| Nmlp_2374 protein network | https://string-db.org/network/268739.Nmlp_2374 | Small CPxCG-related zinc finger protein. |
| Nmlp_2375 protein network | https://string-db.org/network/268739.Nmlp_2375 | ABC-type transport system ATP-binding protein. |
| Nmlp_2376 protein network | https://string-db.org/network/268739.Nmlp_2376 | ABC-type transport system permease protein. |
| Nmlp_2377 protein network | https://string-db.org/network/268739.Nmlp_2377 | ABC-type transport system permease protein. |
| Nmlp_2378 protein network | https://string-db.org/network/268739.Nmlp_2378 | Probable oxidoreductase (aldo-keto reductase family protein). |
| Nmlp_2379 protein network | https://string-db.org/network/268739.Nmlp_2379 | FMN-binding domain protein. |
| Nmlp_2380 protein network | https://string-db.org/network/268739.Nmlp_2380 | DUF2071 family protein. |
| Nmlp_2381 protein network | https://string-db.org/network/268739.Nmlp_2381 | DUF304 domain protein. |
| Nmlp_2382 protein network | https://string-db.org/network/268739.Nmlp_2382 | DUF304 domain protein. |
| Nmlp_2383 protein network | https://string-db.org/network/268739.Nmlp_2383 | Uncharacterized protein. |
| Nmlp_2384 protein network | https://string-db.org/network/268739.Nmlp_2384 | HAD superfamily hydrolase. |
| top6A protein network | https://string-db.org/network/268739.Nmlp_2385 | DNA topoisomerase 6 subunit A; Relaxes both positive and negative superturns and exhibits a strong decatenase activity; Belongs to the TOP6A family. |
| top6B protein network | https://string-db.org/network/268739.Nmlp_2386 | DNA topoisomerase 6 subunit B (intein-containing); Relaxes both positive and negative superturns and exhibits a strong decatenase activity. |
| gyrB protein network | https://string-db.org/network/268739.Nmlp_2388 | DNA gyrase subunit B; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in a [...] |
| gyrA protein network | https://string-db.org/network/268739.Nmlp_2389 | DNA gyrase subunit A; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in a [...] |
| Nmlp_2390 protein network | https://string-db.org/network/268739.Nmlp_2390 | Glyoxalase domain protein. |
| cdc48a protein network | https://string-db.org/network/268739.Nmlp_2391 | AAA-type ATPase (CDC48 subfamily). |
| Nmlp_2392 protein network | https://string-db.org/network/268739.Nmlp_2392 | HTH domain protein. |
| Nmlp_2393 protein network | https://string-db.org/network/268739.Nmlp_2393 | Uncharacterized protein. |
| ahbA protein network | https://string-db.org/network/268739.Nmlp_2396 | Siroheme decarboxylase AhbA; Product: histidine kinase (nonfunctional). |
| trpD2 protein network | https://string-db.org/network/268739.Nmlp_2397 | Probable phosphoribosyltransferase (homolog to anthranilate phosphoribosyltransferase). |
| Nmlp_2398 protein network | https://string-db.org/network/268739.Nmlp_2398 | Uncharacterized protein. |
| Nmlp_2399 protein network | https://string-db.org/network/268739.Nmlp_2399 | HTH domain protein. |
| ppiA protein network | https://string-db.org/network/268739.Nmlp_2400 | CYPL-type peptidylprolyl isomerase. |
| Nmlp_2401 protein network | https://string-db.org/network/268739.Nmlp_2401 | NUDIX family hydrolase. |
| Nmlp_2402 protein network | https://string-db.org/network/268739.Nmlp_2402 | Zinc finger protein. |
| Nmlp_2403 protein network | https://string-db.org/network/268739.Nmlp_2403 | Cupin 2 barrel domain protein. |
| tif2b1 protein network | https://string-db.org/network/268739.Nmlp_2404 | Translation initiation factor aIF-2 beta subunit. |
| Nmlp_2405 protein network | https://string-db.org/network/268739.Nmlp_2405 | FNT family transport protein. |
| Nmlp_2406 protein network | https://string-db.org/network/268739.Nmlp_2406 | UspA domain protein. |
| hmgA protein network | https://string-db.org/network/268739.Nmlp_2407 | hydroxymethylglutaryl-CoA reductase (NADPH); Belongs to the HMG-CoA reductase family. |
| nadA protein network | https://string-db.org/network/268739.Nmlp_2408 | Quinolinate synthase A; Catalyzes the condensation of iminoaspartate with dihydroxyacetone phosphate to form quinolinate. |
| nadB protein network | https://string-db.org/network/268739.Nmlp_2409 | L-aspartate oxidase. |
| nadC protein network | https://string-db.org/network/268739.Nmlp_2410 | Nicotinate-nucleotide pyrophosphorylase (carboxylating); Involved in the catabolism of quinolinic acid (QA). Belongs to the NadC/ModD family. |
| Nmlp_2411 protein network | https://string-db.org/network/268739.Nmlp_2411 | DUF3311 family protein. |
| Nmlp_2412 protein network | https://string-db.org/network/268739.Nmlp_2412 | SSSF family transport protein; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| Nmlp_2413 protein network | https://string-db.org/network/268739.Nmlp_2413 | PfpI family protease. |
| Nmlp_2414 protein network | https://string-db.org/network/268739.Nmlp_2414 | GtrA family protein. |
| Nmlp_2415 protein network | https://string-db.org/network/268739.Nmlp_2415 | AlkP-core domain protein. |
| Nmlp_2416 protein network | https://string-db.org/network/268739.Nmlp_2416 | DUF2892 family protein. |
| fabG2 protein network | https://string-db.org/network/268739.Nmlp_2417 | 3-oxoacyl-[acyl-carrier-protein] reductase. |
| Nmlp_2418 protein network | https://string-db.org/network/268739.Nmlp_2418 | Uncharacterized protein. |
| cheW protein network | https://string-db.org/network/268739.Nmlp_2419 | Purine-binding taxis protein CheW. |
| Nmlp_2420 protein network | https://string-db.org/network/268739.Nmlp_2420 | Uncharacterized protein. |
| arfA protein network | https://string-db.org/network/268739.Nmlp_2421 | GTP cyclohydrolase 3; Catalyzes the formation of 2-amino-5-formylamino-6- ribofuranosylamino-4(3H)-pyrimidinone ribonucleotide monophosphate and inorganic phosphate from GTP. Also has an independ [...] |
| livJ1 protein network | https://string-db.org/network/268739.Nmlp_2422 | ABC-type transport system periplasmic substrate-binding protein (probable substrate branched-chain amino acids). |
| livF1 protein network | https://string-db.org/network/268739.Nmlp_2423 | ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acids). |
| livG1 protein network | https://string-db.org/network/268739.Nmlp_2424 | ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acids). |
| livM1 protein network | https://string-db.org/network/268739.Nmlp_2425 | ABC-type transport system permease protein (probable substrate branched-chain amino acids). |
| livH1 protein network | https://string-db.org/network/268739.Nmlp_2426 | ABC-type transport system permease protein (probable substrate branched-chain amino acids). |
| pgk protein network | https://string-db.org/network/268739.Nmlp_2427 | Phosphoglycerate kinase; Belongs to the phosphoglycerate kinase family. |
| Nmlp_2428 protein network | https://string-db.org/network/268739.Nmlp_2428 | GNAT family acetyltransferase. |
| Nmlp_2429 protein network | https://string-db.org/network/268739.Nmlp_2429 | FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase). |
| rpoL protein network | https://string-db.org/network/268739.Nmlp_2430 | DNA-directed RNA polymerase subunit L; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...] |
| Nmlp_2431 protein network | https://string-db.org/network/268739.Nmlp_2431 | Uncharacterized protein. |
| hisF protein network | https://string-db.org/network/268739.Nmlp_2432 | Imidazoleglycerol-phosphate synthase subunit HisF; IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisF subunit catalyzes the cyclization activity that produ [...] |
| Nmlp_2433 protein network | https://string-db.org/network/268739.Nmlp_2433 | DMT superfamily transport protein. |
| Nmlp_2434 protein network | https://string-db.org/network/268739.Nmlp_2434 | Redoxin domain protein. |
| Nmlp_2435 protein network | https://string-db.org/network/268739.Nmlp_2435 | Probable methyltransferase. |
| mtfK1 protein network | https://string-db.org/network/268739.Nmlp_2436 | FKBP-type peptidylprolyl isomerase. |
| nolA1 protein network | https://string-db.org/network/268739.Nmlp_2437 | arNOG06768 family NADH-binding domain protein. |
| cetZ1 protein network | https://string-db.org/network/268739.Nmlp_2438 | FtsZ family protein CetZ, type III; Involved in cell shape control; Belongs to the CetZ family. |
| Nmlp_2439 protein network | https://string-db.org/network/268739.Nmlp_2439 | Uncharacterized protein. |
| cofC protein network | https://string-db.org/network/268739.Nmlp_2440 | 2-phospho-L-lactate guanylyltransferase; Guanylyltransferase that catalyzes the activation of phosphoenolpyruvate (PEP) as enolpyruvoyl-2-diphospho-5'-guanosine, via the condensation of PEP with [...] |
| cofG protein network | https://string-db.org/network/268739.Nmlp_2441 | 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 1; Catalyzes the radical-mediated synthesis of 7,8-didemethyl-8- hydroxy-5-deazariboflavin (FO) from 5-amino-5-(4-hydroxybenzyl)-6-(D- [...] |
| hsp20B protein network | https://string-db.org/network/268739.Nmlp_2442 | Hsp20-type molecular chaperone; Belongs to the small heat shock protein (HSP20) family. |
| Nmlp_2443 protein network | https://string-db.org/network/268739.Nmlp_2443 | Small CPxCG-related zinc finger protein. |
| Nmlp_2444 protein network | https://string-db.org/network/268739.Nmlp_2444 | Uncharacterized protein. |
| Nmlp_2445 protein network | https://string-db.org/network/268739.Nmlp_2445 | Uncharacterized protein. |
| Nmlp_2446 protein network | https://string-db.org/network/268739.Nmlp_2446 | Radical SAM domain protein. |
| Nmlp_2447 protein network | https://string-db.org/network/268739.Nmlp_2447 | HAD superfamily hydrolase. |
| cbiB protein network | https://string-db.org/network/268739.Nmlp_2448 | Adenosylcobinamide-phosphate synthase; Converts cobyric acid to cobinamide by the addition of aminopropanol on the F carboxylic group. |
| cobS protein network | https://string-db.org/network/268739.Nmlp_2449 | adenosylcobinamide-GDP ribazoletransferase; Joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Also synthesizes adenosylcobalamin 5'-phosphate from ade [...] |
| cobY protein network | https://string-db.org/network/268739.Nmlp_2450 | Adenosylcobinamide-phosphate guanylyltransferase. |
| cobD protein network | https://string-db.org/network/268739.Nmlp_2451 | L-threonine-O-3-phosphate decarboxylase. |
| cbiZ protein network | https://string-db.org/network/268739.Nmlp_2452 | Adenosylcobinamide amidohydrolase. |
| Nmlp_2453 protein network | https://string-db.org/network/268739.Nmlp_2453 | HTH-10 family transcription regulator. |
| Nmlp_2454 protein network | https://string-db.org/network/268739.Nmlp_2454 | Major facilitator superfamily transport protein. |
| PotD protein network | https://string-db.org/network/268739.Nmlp_2455 | ABC-type transport system periplasmic substrate-binding protein. |
| PotA protein network | https://string-db.org/network/268739.Nmlp_2456 | ABC-type transport system ATP-binding protein. |
| PotB protein network | https://string-db.org/network/268739.Nmlp_2457 | ABC-type transport system permease protein. |
| PotC protein network | https://string-db.org/network/268739.Nmlp_2458 | ABC-type transport system permease protein. |
| Nmlp_2461 protein network | https://string-db.org/network/268739.Nmlp_2461 | Uncharacterized protein; Product: ISH14-type transposase ISNamo10 (nonfunctional). |
| Nmlp_2462 protein network | https://string-db.org/network/268739.Nmlp_2462 | Uncharacterized protein. |
| Nmlp_2463 protein network | https://string-db.org/network/268739.Nmlp_2463 | Uncharacterized protein. |
| Nmlp_2464 protein network | https://string-db.org/network/268739.Nmlp_2464 | DoxX domain protein. |
| Nmlp_2465 protein network | https://string-db.org/network/268739.Nmlp_2465 | HiPIP domain protein. |
| Nmlp_2466 protein network | https://string-db.org/network/268739.Nmlp_2466 | SpoVR family protein. |
| Nmlp_2467 protein network | https://string-db.org/network/268739.Nmlp_2467 | UPF0229 family protein. |
| prkA2 protein network | https://string-db.org/network/268739.Nmlp_2469 | Probable PrkA-type serine/threonine protein kinase. |
| prkA1 protein network | https://string-db.org/network/268739.Nmlp_2470 | Probable PrkA-type serine/threonine protein kinase. |
| Nmlp_2471 protein network | https://string-db.org/network/268739.Nmlp_2471 | Uncharacterized protein. |
| cdd protein network | https://string-db.org/network/268739.Nmlp_2473 | Cytidine deaminase; Gene has frameshifts; locus_tag: Nmlp_2472; product: IS1341-type transposase NmIRS25 (nonfunctional); conceptual translation after in silico reconstruction: MEYSHRYPAYPTQQVVGE [...] |
| udp1 protein network | https://string-db.org/network/268739.Nmlp_2474 | Uridine phosphorylase. |
| ndh protein network | https://string-db.org/network/268739.Nmlp_2475 | Probable NADH dehydrogenase. |
| Nmlp_2476 protein network | https://string-db.org/network/268739.Nmlp_2476 | DUF293 domain protein. |
| Nmlp_2477 protein network | https://string-db.org/network/268739.Nmlp_2477 | P-type transport ATPase (probable substrate copper/metal cation). |
| cbaE protein network | https://string-db.org/network/268739.Nmlp_2478 | Ba3-type terminal oxidase subunit CbaE. |
| cbaD protein network | https://string-db.org/network/268739.Nmlp_2479 | Ba3-type terminal oxidase subunit CbaD. |
| cbaB protein network | https://string-db.org/network/268739.Nmlp_2480 | Ba3-type terminal oxidase subunit II. |
| cbaA protein network | https://string-db.org/network/268739.Nmlp_2481 | Ba3-type terminal oxidase subunit I. |
| cbaC protein network | https://string-db.org/network/268739.Nmlp_2482 | CbaC protein. |
| tspO protein network | https://string-db.org/network/268739.Nmlp_2483 | TspO family protein. |
| surE protein network | https://string-db.org/network/268739.Nmlp_2484 | 5'-nucleotidase SurE; Nucleotidase that shows phosphatase activity on nucleoside 5'-monophosphates; Belongs to the SurE nucleotidase family. |
| Nmlp_2485 protein network | https://string-db.org/network/268739.Nmlp_2485 | Beta-lactamase domain protein. |
| orc3 protein network | https://string-db.org/network/268739.Nmlp_2486 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. |
| fadA5 protein network | https://string-db.org/network/268739.Nmlp_2487 | enoyl-CoA hydratase; Belongs to the enoyl-CoA hydratase/isomerase family. |
| BdbD protein network | https://string-db.org/network/268739.Nmlp_2488 | Thioredoxin domain protein. |
| Nmlp_2489 protein network | https://string-db.org/network/268739.Nmlp_2489 | Glyoxalase domain protein. |
| Nmlp_2490 protein network | https://string-db.org/network/268739.Nmlp_2490 | Uncharacterized protein. |
| Nmlp_2491 protein network | https://string-db.org/network/268739.Nmlp_2491 | IS1341-type transposase ISNamo20. |
| Nmlp_2492 protein network | https://string-db.org/network/268739.Nmlp_2492 | KaiC domain protein. |
| Nmlp_2493 protein network | https://string-db.org/network/268739.Nmlp_2493 | Sensor box histidine kinase. |
| Nmlp_2495 protein network | https://string-db.org/network/268739.Nmlp_2495 | Integrase family protein; Product: ABC-type transport system permease protein (nonfunctional). |
| Nmlp_2497 protein network | https://string-db.org/network/268739.Nmlp_2497 | ISH7-type transposase NmIRS21. |
| Nmlp_2498 protein network | https://string-db.org/network/268739.Nmlp_2498 | Uncharacterized protein. |
| Nmlp_2499 protein network | https://string-db.org/network/268739.Nmlp_2499 | NikR family transcription regulator. |
| Nmlp_2500 protein network | https://string-db.org/network/268739.Nmlp_2500 | Uncharacterized protein. |
| Nmlp_2501 protein network | https://string-db.org/network/268739.Nmlp_2501 | Uncharacterized protein. |
| parA3 protein network | https://string-db.org/network/268739.Nmlp_2502 | ParA domain protein. |
| polY2 protein network | https://string-db.org/network/268739.Nmlp_2504 | DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismat [...] |
| Nmlp_2505 protein network | https://string-db.org/network/268739.Nmlp_2505 | Uncharacterized protein. |
| Nmlp_2506 protein network | https://string-db.org/network/268739.Nmlp_2506 | Small CPxCG-related zinc finger protein. |
| Nmlp_2507 protein network | https://string-db.org/network/268739.Nmlp_2507 | Uncharacterized protein. |
| Nmlp_2508 protein network | https://string-db.org/network/268739.Nmlp_2508 | Uncharacterized protein. |
| Nmlp_2509 protein network | https://string-db.org/network/268739.Nmlp_2509 | ISH9-type transposase NmIRS1. |
| Nmlp_2510 protein network | https://string-db.org/network/268739.Nmlp_2510 | Uncharacterized protein; Gene has an in-frame stop codon and is truncated at the C-terminus; product: ISH9-type transposase NmIRS4 (nonfunctional); locus_tag: Nmlp_2509A. |
| tbp3 protein network | https://string-db.org/network/268739.Nmlp_2511 | TATA-binding transcription initiation factor; General factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Binds specifically to the TATA box promoter eleme [...] |
| CCQ36677.1 protein network | https://string-db.org/network/268739.Nmlp_2512A | Uncharacterized protein. |
| Nmlp_2513 protein network | https://string-db.org/network/268739.Nmlp_2513 | ISH10-type transposase ISNamo3. |
| Nmlp_2516 protein network | https://string-db.org/network/268739.Nmlp_2516 | Gene has an in-frame stop codon and is truncated at the N-terminus; product: ISH3-type transposase NmIRS57 (nonfunctional); locus_tag: Nmlp_2514A. |
| tbp2 protein network | https://string-db.org/network/268739.Nmlp_2517 | TATA-binding transcription initiation factor; General factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Binds specifically to the TATA box promoter eleme [...] |
| orc4 protein network | https://string-db.org/network/268739.Nmlp_2518 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. |
| cbs13 protein network | https://string-db.org/network/268739.Nmlp_2519 | DUF21/CBS domain protein. |
| Nmlp_2521 protein network | https://string-db.org/network/268739.Nmlp_2521 | Probable FAD-dependent oxidoreductase. |
| Nmlp_2522 protein network | https://string-db.org/network/268739.Nmlp_2522 | Uncharacterized protein. |
| Nmlp_2525 protein network | https://string-db.org/network/268739.Nmlp_2525 | UPF0066 family protein; Gene has a frameshift; locus_tag: Nmlp_2524; product: ISH9-type transposase NmIRS2 (nonfunctional); conceptual translation after in silico reconstruction: MQALPESRLLRFVEQA [...] |
| Nmlp_2526 protein network | https://string-db.org/network/268739.Nmlp_2526 | Uncharacterized protein. |
| Nmlp_2527 protein network | https://string-db.org/network/268739.Nmlp_2527 | Uncharacterized protein. |
| Nmlp_2529 protein network | https://string-db.org/network/268739.Nmlp_2529 | PQQ repeat protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2528; product: ISH14-type transposase ISNamo7 (nonfunctional); conceptual translation after in silico re [...] |
| Nmlp_2530 protein network | https://string-db.org/network/268739.Nmlp_2530 | PQQ repeat protein / protein kinase domain protein. |
| Nmlp_2531 protein network | https://string-db.org/network/268739.Nmlp_2531 | Protein kinase domain protein. |
| Nmlp_2533 protein network | https://string-db.org/network/268739.Nmlp_2533 | DnaK domain protein / protein kinase domain protein; Gene has a frameshift; locus_tag: Nmlp_2532; product: ISH4-type transposase NmIRS7 (nonfunctional); conceptual translation after in silico rec [...] |
| Nmlp_2535 protein network | https://string-db.org/network/268739.Nmlp_2535 | Protein kinase domain protein; Gene has in-frame stop codons; locus_tag: Nmlp_2534; product: ISH3-type transposase NmIRS13 (nonfunctional); conceptual translation after in silico reconstruction: [...] |
| Nmlp_2539 protein network | https://string-db.org/network/268739.Nmlp_2539 | Uncharacterized protein; Product: ISH14-type transposase NmIRS16 (nonfunctional). |
| Nmlp_2540 protein network | https://string-db.org/network/268739.Nmlp_2540 | Uncharacterized protein. |
| pspA2 protein network | https://string-db.org/network/268739.Nmlp_2541 | PspA domain protein. |
| Nmlp_2542 protein network | https://string-db.org/network/268739.Nmlp_2542 | AAA-type ATPase core domain protein; Belongs to the AAA ATPase family. |
| Nmlp_2543 protein network | https://string-db.org/network/268739.Nmlp_2543 | Uncharacterized protein. |
| prpC protein network | https://string-db.org/network/268739.Nmlp_2544 | Phosphoprotein phosphatase. |
| Nmlp_2545 protein network | https://string-db.org/network/268739.Nmlp_2545 | PQQ repeat protein / protein kinase domain protein. |
| Nmlp_2546 protein network | https://string-db.org/network/268739.Nmlp_2546 | Protein kinase domain protein. |
| Nmlp_2547 protein network | https://string-db.org/network/268739.Nmlp_2547 | ISHwa4-type transposase ISNamo5. |
| Nmlp_2549 protein network | https://string-db.org/network/268739.Nmlp_2549 | Protein kinase domain protein / halocyanin domain protein; Product: ISH14-type transposase ISNamo7 (nonfunctional). |
| Nmlp_2550 protein network | https://string-db.org/network/268739.Nmlp_2550 | ISH10-type transposase ISNamo3. |
| ferA3 protein network | https://string-db.org/network/268739.Nmlp_2556 | Ferredoxin (2Fe-2S). |
| dpsA3 protein network | https://string-db.org/network/268739.Nmlp_2557 | Ferritin / Dps domain protein. |
| Nmlp_2558 protein network | https://string-db.org/network/268739.Nmlp_2558 | HTH-10 family transcription regulator. |
| Nmlp_2559 protein network | https://string-db.org/network/268739.Nmlp_2559 | UPF0061 family protein. |
| Nmlp_2560 protein network | https://string-db.org/network/268739.Nmlp_2560 | TrmB family transcription regulator. |
| Nmlp_2561 protein network | https://string-db.org/network/268739.Nmlp_2561 | Uncharacterized protein. |
| Nmlp_2562 protein network | https://string-db.org/network/268739.Nmlp_2562 | Uncharacterized protein. |
| Nmlp_2563 protein network | https://string-db.org/network/268739.Nmlp_2563 | AbrB/VapB family protein. |
| Nmlp_2564 protein network | https://string-db.org/network/268739.Nmlp_2564 | Uncharacterized protein. |
| Nmlp_2565 protein network | https://string-db.org/network/268739.Nmlp_2565 | Uncharacterized protein. |
| Nmlp_2567 protein network | https://string-db.org/network/268739.Nmlp_2567 | Uncharacterized protein. |
| Nmlp_2568 protein network | https://string-db.org/network/268739.Nmlp_2568 | Uncharacterized protein. |
| Nmlp_2569 protein network | https://string-db.org/network/268739.Nmlp_2569 | HD family hydrolase. |
| Nmlp_2570 protein network | https://string-db.org/network/268739.Nmlp_2570 | ARM/HEAT repeat protein. |
| Nmlp_2572 protein network | https://string-db.org/network/268739.Nmlp_2572 | IS1341-type transposase ISNamo24; Gene has been targetted by a transposon; locus_tag: Nmlp_2571; product: small CPxCG-related zinc finger protein (nonfunctional); conceptual translation after in [...] |
| Nmlp_2574 protein network | https://string-db.org/network/268739.Nmlp_2574 | Uncharacterized protein; Gene has an in-frame stop codon; locus_tag: Nmlp_2573; product: homolog to small CPxCG-related zinc finger protein (nonfunctional); conceptual translation after in silico [...] |
| Nmlp_2575 protein network | https://string-db.org/network/268739.Nmlp_2575 | Uncharacterized protein. |
| Nmlp_2576 protein network | https://string-db.org/network/268739.Nmlp_2576 | AAA-type ATPase domain protein. |
| Nmlp_2577 protein network | https://string-db.org/network/268739.Nmlp_2577 | Uncharacterized protein. |
| Nmlp_2578 protein network | https://string-db.org/network/268739.Nmlp_2578 | Probable helicase. |
| Nmlp_2581 protein network | https://string-db.org/network/268739.Nmlp_2581 | UvrD/REP family helicase. |
| Nmlp_2582 protein network | https://string-db.org/network/268739.Nmlp_2582 | Homolog to nuclease subunit B. |
| Nmlp_2583 protein network | https://string-db.org/network/268739.Nmlp_2583 | AAA-type ATPase domain protein; Gene has an in-frame stop codon and is truncated at the C-terminus; product: ISH11-type transposase NmIRS56 (nonfunctional); locus_tag: Nmlp_2582A. |
| Nmlp_2584 protein network | https://string-db.org/network/268739.Nmlp_2584 | Homolog to 5-methylcytosine restriction system protein McrC. |
| Nmlp_2586 protein network | https://string-db.org/network/268739.Nmlp_2586 | ISH14-type transposase ISNamo7. |
| Nmlp_2587 protein network | https://string-db.org/network/268739.Nmlp_2587 | Uncharacterized protein. |
| Nmlp_2588 protein network | https://string-db.org/network/268739.Nmlp_2588 | Uncharacterized protein. |
| Nmlp_2589 protein network | https://string-db.org/network/268739.Nmlp_2589 | Adenine-specific DNA modification methylase. |
| Nmlp_2590 protein network | https://string-db.org/network/268739.Nmlp_2590 | ISH14-type transposase ISNamo13. |
| Nmlp_2592 protein network | https://string-db.org/network/268739.Nmlp_2592 | tRNA-Glu; anticodon=CTC. |
| folA1 protein network | https://string-db.org/network/268739.Nmlp_2593 | Dihydrofolate reductase; Belongs to the dihydrofolate reductase family. |
| hts protein network | https://string-db.org/network/268739.Nmlp_2594 | Thymidylate synthase; Catalyzes the reductive methylation of 2'-deoxyuridine-5'- monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate ( [...] |
| Nmlp_2595 protein network | https://string-db.org/network/268739.Nmlp_2595 | Cupin 2 barrel domain protein. |
| cre3n protein network | https://string-db.org/network/268739.Nmlp_2596 | Creatininase domain protein. |
| Nmlp_2597 protein network | https://string-db.org/network/268739.Nmlp_2597 | Integrase family protein. |
| cre2 protein network | https://string-db.org/network/268739.Nmlp_2598 | Creatininase domain protein. |
| Nmlp_2599 protein network | https://string-db.org/network/268739.Nmlp_2599 | Uncharacterized protein. |
| Nmlp_2600 protein network | https://string-db.org/network/268739.Nmlp_2600 | Uncharacterized protein. |
| Nmlp_2601 protein network | https://string-db.org/network/268739.Nmlp_2601 | Uncharacterized protein. |
| Nmlp_2602 protein network | https://string-db.org/network/268739.Nmlp_2602 | Uncharacterized protein. |
| Nmlp_2607 protein network | https://string-db.org/network/268739.Nmlp_2607 | Probable secreted glycoprotein; Product: uncharacterized protein (nonfunctional). |
| Nmlp_2609 protein network | https://string-db.org/network/268739.Nmlp_2609 | ISHwa16-type transposase ISNamo14. |
| Nmlp_2611 protein network | https://string-db.org/network/268739.Nmlp_2611 | ISH14-type transposase ISNamo13. |
| Nmlp_2612 protein network | https://string-db.org/network/268739.Nmlp_2612 | ISHwa16-type transposase ISNamo15. |
| Nmlp_2616 protein network | https://string-db.org/network/268739.Nmlp_2616 | Probable DEAD/DEAH box helicase. |
| Nmlp_2617 protein network | https://string-db.org/network/268739.Nmlp_2617 | Ribonuclease H domain protein. |
| Nmlp_2618 protein network | https://string-db.org/network/268739.Nmlp_2618 | Uncharacterized protein. |
| Nmlp_2619 protein network | https://string-db.org/network/268739.Nmlp_2619 | Uncharacterized protein. |
| znuB3 protein network | https://string-db.org/network/268739.Nmlp_2620 | ABC-type transport system permease protein (probable substrate zinc). |
| znuC3 protein network | https://string-db.org/network/268739.Nmlp_2621 | ABC-type transport system ATP-binding protein (probable substrate zinc). |
| znuA3 protein network | https://string-db.org/network/268739.Nmlp_2622 | ABC-type transport system periplasmic substrate-binding protein (probable substrate zinc). |
| Nmlp_2623 protein network | https://string-db.org/network/268739.Nmlp_2623 | Uncharacterized protein. |
| iscU2 protein network | https://string-db.org/network/268739.Nmlp_2625 | Iron-sulfur cluster assembly protein; Gene has a frameshift; locus_tag: Nmlp_2624; product: cobalt-factor-II C20-methyltransferase (nonfunctional); conceptual translation after in silico reconstr [...] |
| moaB2 protein network | https://string-db.org/network/268739.Nmlp_2626 | Molybdopterin adenylyltransferase. |
| Nmlp_2627 protein network | https://string-db.org/network/268739.Nmlp_2627 | CobW domain protein. |
| Nmlp_2628 protein network | https://string-db.org/network/268739.Nmlp_2628 | CobW domain protein. |
| Nmlp_2629 protein network | https://string-db.org/network/268739.Nmlp_2629 | NikR family transcription regulator; Transcriptional regulator; Belongs to the transcriptional regulatory CopG/NikR family. |
| Nmlp_2630 protein network | https://string-db.org/network/268739.Nmlp_2630 | ISH3-type transposase ISNamo6. |
| Nmlp_2632 protein network | https://string-db.org/network/268739.Nmlp_2632 | NikR family transcription regulator; Product: IS1341-type transposase NmIRS29 (nonfunctional). |
| CbiO protein network | https://string-db.org/network/268739.Nmlp_2634 | ABC-type transport system ATP-binding protein (probable substrate cobalt/nickel/biotin). |
| CbiQ protein network | https://string-db.org/network/268739.Nmlp_2635 | ABC-type transport system permease protein (probable substrate cobalt/nickel/biotin). |
| Nmlp_2636 protein network | https://string-db.org/network/268739.Nmlp_2636 | ABC-type transport system small membrane protein (probable substrate cobalt/nickel/biotin). |
| CbiM protein network | https://string-db.org/network/268739.Nmlp_2637 | ABC-type transport system permease protein (probable substrate cobalt/nickel/biotin). |
| Nmlp_2638 protein network | https://string-db.org/network/268739.Nmlp_2638 | NikR family transcription regulator. |
| Nmlp_2639 protein network | https://string-db.org/network/268739.Nmlp_2639 | NikR family transcription regulator; Transcriptional regulator; Belongs to the transcriptional regulatory CopG/NikR family. |
| Nmlp_2640 protein network | https://string-db.org/network/268739.Nmlp_2640 | UPF0175 family protein. |
| Nmlp_2641 protein network | https://string-db.org/network/268739.Nmlp_2641 | PIN domain protein. |
| parA2 protein network | https://string-db.org/network/268739.Nmlp_2642 | ParA domain protein. |
| Nmlp_2643 protein network | https://string-db.org/network/268739.Nmlp_2643 | Uncharacterized protein. |
| Nmlp_2645 protein network | https://string-db.org/network/268739.Nmlp_2645 | DUF3006 family protein; Gene has an in-frame stop codon; locus_tag: Nmlp_2644; product: beta-lactamase domain protein (nonfunctional); conceptual translation after in silico reconstruction: MKRLH [...] |
| Nmlp_2646 protein network | https://string-db.org/network/268739.Nmlp_2646 | Homolog to restriction system mrr N-terminal region. |
| Nmlp_2647 protein network | https://string-db.org/network/268739.Nmlp_2647 | Uncharacterized protein. |
| Nmlp_2648 protein network | https://string-db.org/network/268739.Nmlp_2648 | HTH domain protein. |
| Nmlp_2649 protein network | https://string-db.org/network/268739.Nmlp_2649 | ArsR family transcription regulator / DUF2204 family protein. |
| Nmlp_2650 protein network | https://string-db.org/network/268739.Nmlp_2650 | Probable secreted glycoprotein. |
| Nmlp_2651 protein network | https://string-db.org/network/268739.Nmlp_2651 | IS1341-type transposase ISNamo25. |
| Nmlp_2652 protein network | https://string-db.org/network/268739.Nmlp_2652 | Uncharacterized protein. |
| Nmlp_2653 protein network | https://string-db.org/network/268739.Nmlp_2653 | Receiver/bat box HTH-10 family transcription regulator. |
| Nmlp_2654 protein network | https://string-db.org/network/268739.Nmlp_2654 | Histidine kinase. |
| Nmlp_2655 protein network | https://string-db.org/network/268739.Nmlp_2655 | Probable secreted glycoprotein. |
| orc5 protein network | https://string-db.org/network/268739.Nmlp_2657 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. |
| Nmlp_2658 protein network | https://string-db.org/network/268739.Nmlp_2658 | Uncharacterized protein. |
| Nmlp_2659 protein network | https://string-db.org/network/268739.Nmlp_2659 | MazG family protein. |
| Nmlp_2660 protein network | https://string-db.org/network/268739.Nmlp_2660 | Probable ATP/GTP-binding protein. |
| Nmlp_2661 protein network | https://string-db.org/network/268739.Nmlp_2661 | Uncharacterized protein. |
| Nmlp_2662 protein network | https://string-db.org/network/268739.Nmlp_2662 | Uncharacterized protein. |
| Nmlp_2663 protein network | https://string-db.org/network/268739.Nmlp_2663 | HTH domain protein. |
| Nmlp_2664 protein network | https://string-db.org/network/268739.Nmlp_2664 | Uncharacterized protein. |
| Nmlp_2665 protein network | https://string-db.org/network/268739.Nmlp_2665 | IS200-type transposase ISNamo17. |
| Nmlp_2666 protein network | https://string-db.org/network/268739.Nmlp_2666 | IS1341-type transposase ISNamo17. |
| tfbA6 protein network | https://string-db.org/network/268739.Nmlp_2668 | Transcription initiation factor TFB; Product: PIN domain protein (nonfunctional). |
| cspA2 protein network | https://string-db.org/network/268739.Nmlp_2669 | Cold shock protein. |
| Nmlp_2671 protein network | https://string-db.org/network/268739.Nmlp_2671 | Nucleotidyltransferase domain protein. |
| Nmlp_2672 protein network | https://string-db.org/network/268739.Nmlp_2672 | DUF86 family protein. |
| Nmlp_2673 protein network | https://string-db.org/network/268739.Nmlp_2673 | Uncharacterized protein. |
| Nmlp_2675 protein network | https://string-db.org/network/268739.Nmlp_2675 | Uncharacterized protein. |
| Nmlp_2676 protein network | https://string-db.org/network/268739.Nmlp_2676 | Uncharacterized protein. |
| Nmlp_2677 protein network | https://string-db.org/network/268739.Nmlp_2677 | Uncharacterized protein. |
| Nmlp_2678 protein network | https://string-db.org/network/268739.Nmlp_2678 | Uncharacterized protein. |
| Nmlp_2680 protein network | https://string-db.org/network/268739.Nmlp_2680 | FMO domain protein; Gene has an in-frame stop codon and is truncated at both termini; product: ISH9-type transposase NmIRS4 (nonfunctional); locus_tag: Nmlp_2679B. |
| Nmlp_2682 protein network | https://string-db.org/network/268739.Nmlp_2682 | Uncharacterized protein; Gene has a frameshift and is truncated at the C-terminus; locus_tag: Nmlp_2681; product: ISH9-type transposase NmIRS5 (nonfunctional). |
| Nmlp_2683 protein network | https://string-db.org/network/268739.Nmlp_2683 | Uncharacterized protein. |
| Nmlp_2684 protein network | https://string-db.org/network/268739.Nmlp_2684 | Uncharacterized protein. |
| Nmlp_2685 protein network | https://string-db.org/network/268739.Nmlp_2685 | Uncharacterized protein. |
| phr3 protein network | https://string-db.org/network/268739.Nmlp_2686 | Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. |
| rtcB1 protein network | https://string-db.org/network/268739.Nmlp_2687 | tRNA-splicing ligase RtcB; Belongs to the RtcB family. |
| cheB protein network | https://string-db.org/network/268739.Nmlp_2688 | Protein-glutamate methylesterase CheB; Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylatio [...] |
| cheA protein network | https://string-db.org/network/268739.Nmlp_2689 | Taxis sensor histidine kinase CheA. |
| cheR protein network | https://string-db.org/network/268739.Nmlp_2690 | Protein-glutamate O-methyltransferase CheR. |
| Nmlp_2691 protein network | https://string-db.org/network/268739.Nmlp_2691 | HEAT-PBS family taxis protein. |
| cheF1 protein network | https://string-db.org/network/268739.Nmlp_2692 | Taxis protein CheF1. |
| dph2 protein network | https://string-db.org/network/268739.Nmlp_2693 | 2-(3-amino-3-carboxypropyl)histidine synthase; Catalyzes the first step of diphthamide biosynthesis, i.e. the transfer of the 3-amino-3-carboxypropyl group from S-adenosyl-L- methionine (SAM) to [...] |
| Nmlp_2694 protein network | https://string-db.org/network/268739.Nmlp_2694 | DUF964 family protein. |
| Nmlp_2695 protein network | https://string-db.org/network/268739.Nmlp_2695 | Metal-dependent hydrolase domain protein. |
| Nmlp_2696 protein network | https://string-db.org/network/268739.Nmlp_2696 | Probable coiled coil protein. |
| Nmlp_2697 protein network | https://string-db.org/network/268739.Nmlp_2697 | Uncharacterized protein. |
| Nmlp_2698 protein network | https://string-db.org/network/268739.Nmlp_2698 | XerC/D-like integrase. |
| Nmlp_2699 protein network | https://string-db.org/network/268739.Nmlp_2699 | Uncharacterized protein. |
| Nmlp_2701 protein network | https://string-db.org/network/268739.Nmlp_2701 | ISH7-type transposase NmIRS22. |
| Nmlp_2702 protein network | https://string-db.org/network/268739.Nmlp_2702 | Uncharacterized protein. |
| Nmlp_2704 protein network | https://string-db.org/network/268739.Nmlp_2704 | UPF0175 family protein; Gene has an in-frame stop codon; locus_tag: Nmlp_2703; product: PIN domain protein (nonfunctional); conceptual translation after in silico reconstruction: MTGDDIPANPSVLNTT [...] |
| CDN30045.1 protein network | https://string-db.org/network/268739.Nmlp_2704A | Uncharacterized protein. |
| Nmlp_2705 protein network | https://string-db.org/network/268739.Nmlp_2705 | DUF964 family protein. |
| arsA4 protein network | https://string-db.org/network/268739.Nmlp_2706 | ArsA-type transport ATPase (probable substrate arsenite). |
| arsD1 protein network | https://string-db.org/network/268739.Nmlp_2707 | Transcription regulator ArsD. |
| Nmlp_2708 protein network | https://string-db.org/network/268739.Nmlp_2708 | ArsR family transcription regulator. |
| Nmlp_2709 protein network | https://string-db.org/network/268739.Nmlp_2709 | Uncharacterized protein. |
| Nmlp_2710 protein network | https://string-db.org/network/268739.Nmlp_2710 | Transport protein (probable substrate arsenite). |
| arsM protein network | https://string-db.org/network/268739.Nmlp_2711 | Probable arsenite(III)-methyltransferase. |
| arsC1 protein network | https://string-db.org/network/268739.Nmlp_2712 | Arsenate reductase (glutaredoxin). |
| Nmlp_2713 protein network | https://string-db.org/network/268739.Nmlp_2713 | ArsR family transcription regulator. |
| fdhA protein network | https://string-db.org/network/268739.Nmlp_2714 | Formate dehydrogenase alpha subunit. |
| Nmlp_2715 protein network | https://string-db.org/network/268739.Nmlp_2715 | ABC-type transport system ATP-binding protein. |
| acaB1 protein network | https://string-db.org/network/268739.Nmlp_2716 | acetyl-CoA C-acetyltransferase catalytic subunit. |
| Nmlp_2717 protein network | https://string-db.org/network/268739.Nmlp_2717 | acetyl-CoA C-acetyltransferase small subunit. |
| Nmlp_2718 protein network | https://string-db.org/network/268739.Nmlp_2718 | Uncharacterized protein. |
| Nmlp_2719 protein network | https://string-db.org/network/268739.Nmlp_2719 | Uncharacterized protein. |
| dpsA1 protein network | https://string-db.org/network/268739.Nmlp_2720 | Ferritin DpsA; Belongs to the Dps family. |
| rpl8e protein network | https://string-db.org/network/268739.Nmlp_2722 | 50S ribosomal protein L8e; Multifunctional RNA-binding protein that recognizes the K- turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs. |
| rps28e protein network | https://string-db.org/network/268739.Nmlp_2723 | 30S ribosomal protein S28e; Belongs to the eukaryotic ribosomal protein eS28 family. |
| rpl24e protein network | https://string-db.org/network/268739.Nmlp_2724 | 50S ribosomal protein L24e; Binds to the 23S rRNA; Belongs to the eukaryotic ribosomal protein eL24 family. |
| ndk protein network | https://string-db.org/network/268739.Nmlp_2725 | Nucleoside-diphosphate kinase; Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, [...] |
| metE1 protein network | https://string-db.org/network/268739.Nmlp_2726 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase (methionine synthase II). |
| metE2 protein network | https://string-db.org/network/268739.Nmlp_2727 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase (methionine synthase II). |
| prmC protein network | https://string-db.org/network/268739.Nmlp_2728 | Probable S-adenosylmethionine-dependent methyltransferase PrmC. |
| Nmlp_2729 protein network | https://string-db.org/network/268739.Nmlp_2729 | Uncharacterized protein. |
| ksgA protein network | https://string-db.org/network/268739.Nmlp_2730 | Ribosome biogenesis protein KsgA, 16S rRNA-methylating; Specifically dimethylates two adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May p [...] |
| Nmlp_2731 protein network | https://string-db.org/network/268739.Nmlp_2731 | Putative tRNA-specific adenosine deaminase. |
| rpoF protein network | https://string-db.org/network/268739.Nmlp_2732 | DNA-directed RNA polymerase subunit F. |
| rpl21e protein network | https://string-db.org/network/268739.Nmlp_2733 | 50S ribosomal protein L21e; Belongs to the eukaryotic ribosomal protein eL21 family. |
| tef1b protein network | https://string-db.org/network/268739.Nmlp_2734 | Translation elongation factor aEF-1 beta subunit; Promotes the exchange of GDP for GTP in EF-1-alpha/GDP, thus allowing the regeneration of EF-1-alpha/GTP that could then be used to form the tern [...] |
| Nmlp_2735 protein network | https://string-db.org/network/268739.Nmlp_2735 | Small CPxCG-related zinc finger protein. |
| tmcA protein network | https://string-db.org/network/268739.Nmlp_2736 | tRNA(Met) cytidine acetyltransferase TmcA; Catalyzes the formation of N(4)-acetylcytidine (ac(4)C) at the wobble position of tRNA(Met), by using acetyl-CoA as an acetyl donor and ATP (or GTP). |
| ferB1 protein network | https://string-db.org/network/268739.Nmlp_2737 | Ferredoxin (3Fe-4S)(4Fe-4S), zinc-containing. |
| gltS protein network | https://string-db.org/network/268739.Nmlp_2738 | glutamate--tRNA(Glu/Gln) ligase; Catalyzes the attachment of glutamate to tRNA(Glu) in a two- step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the accept [...] |
| idsA1 protein network | https://string-db.org/network/268739.Nmlp_2739 | Bifunctional short chain isoprenyl diphosphate synthase; Belongs to the FPP/GGPP synthase family. |
| rnj protein network | https://string-db.org/network/268739.Nmlp_2740 | Ribonuclease J; An RNase that has 5'-3' exonuclease activity. May be involved in RNA degradation; Belongs to the metallo-beta-lactamase superfamily. RNA- metabolizing metallo-beta-lactamase-like [...] |
| Nmlp_2741 protein network | https://string-db.org/network/268739.Nmlp_2741 | Isopentenyl phosphate kinase; Catalyzes the phosphorylation of isopentenyl phosphate (IP) to isopentenyl diphosphate (IPP). Functions in an alternate mevalonate (MVA) pathway leading to IPP, a ke [...] |
| mvk protein network | https://string-db.org/network/268739.Nmlp_2742 | Mevalonate kinase; Catalyzes the phosphorylation of (R)-mevalonate (MVA) to (R)- mevalonate 5-phosphate (MVAP). Functions in the mevalonate (MVA) pathway leading to isopentenyl diphosphate (IPP), [...] |
| nosL2 protein network | https://string-db.org/network/268739.Nmlp_2743 | NosL family protein. |
| Nmlp_2744 protein network | https://string-db.org/network/268739.Nmlp_2744 | Uncharacterized protein. |
| rps2 protein network | https://string-db.org/network/268739.Nmlp_2745 | 30S ribosomal protein S2; Belongs to the universal ribosomal protein uS2 family. |
| eno protein network | https://string-db.org/network/268739.Nmlp_2746 | Enolase; Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. It is essential for the degradation of carbohydrates via glycolysis; Belongs to the enolase family. |
| rpoK protein network | https://string-db.org/network/268739.Nmlp_2747 | DNA-directed RNA polymerase subunit K; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...] |
| rpoN protein network | https://string-db.org/network/268739.Nmlp_2748 | DNA-directed RNA polymerase subunit N; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...] |
| rps9 protein network | https://string-db.org/network/268739.Nmlp_2749 | 30S ribosomal protein S9; Belongs to the universal ribosomal protein uS9 family. |
| rpl13 protein network | https://string-db.org/network/268739.Nmlp_2750 | 50S ribosomal protein L13; This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages [...] |
| rpl18e protein network | https://string-db.org/network/268739.Nmlp_2751 | 50S ribosomal protein L18e; Belongs to the eukaryotic ribosomal protein eL18 family. |
| rpoD protein network | https://string-db.org/network/268739.Nmlp_2752 | DNA-directed RNA polymerase subunit D; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...] |
| rps11 protein network | https://string-db.org/network/268739.Nmlp_2753 | 30S ribosomal protein S11; Located on the platform of the 30S subunit. Belongs to the universal ribosomal protein uS11 family. |
| rps4 protein network | https://string-db.org/network/268739.Nmlp_2754 | 30S ribosomal protein S4; One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the body of the 30S subunit. |
| rps13 protein network | https://string-db.org/network/268739.Nmlp_2755 | 30S ribosomal protein S13; Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 [...] |
| apbC1 protein network | https://string-db.org/network/268739.Nmlp_2756 | Fe-S cluster carrier protein ApbC; Binds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP; Belongs to the Mrp/NBP35 ATP-binding proteins family. |
| Nmlp_2757 protein network | https://string-db.org/network/268739.Nmlp_2757 | Uncharacterized protein. |
| Nmlp_2758 protein network | https://string-db.org/network/268739.Nmlp_2758 | PQQ repeat protein. |
| rps6e protein network | https://string-db.org/network/268739.Nmlp_2759 | 30S ribosomal protein S6e; Belongs to the eukaryotic ribosomal protein eS6 family. |
| Nmlp_2760 protein network | https://string-db.org/network/268739.Nmlp_2760 | Uncharacterized protein. |
| coaBC protein network | https://string-db.org/network/268739.Nmlp_2761 | Phosphopantothenoylcysteine decarboxylase / phosphopantothenate--cysteine ligase. |
| Nmlp_2762 protein network | https://string-db.org/network/268739.Nmlp_2762 | START domain protein. |
| Nmlp_2763 protein network | https://string-db.org/network/268739.Nmlp_2763 | Uncharacterized protein. |
| moeA1 protein network | https://string-db.org/network/268739.Nmlp_2764 | Molybdopterin molybdenumtransferase. |
| moeA2 protein network | https://string-db.org/network/268739.Nmlp_2765 | Molybdopterin molybdenumtransferase. |
| Nmlp_2766 protein network | https://string-db.org/network/268739.Nmlp_2766 | Uncharacterized protein. |
| hsp20C protein network | https://string-db.org/network/268739.Nmlp_2767 | Hsp20-type molecular chaperone; Belongs to the small heat shock protein (HSP20) family. |
| Nmlp_2768 protein network | https://string-db.org/network/268739.Nmlp_2768 | UbiB family protein. |
| tfeA protein network | https://string-db.org/network/268739.Nmlp_2769 | Transcription initiation factor TFE; Transcription factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Facilitates transcription initiation by enhancing TA [...] |
| Nmlp_2770 protein network | https://string-db.org/network/268739.Nmlp_2770 | DUF2110 family protein. |
| Nmlp_2771 protein network | https://string-db.org/network/268739.Nmlp_2771 | Uncharacterized protein. |
| CinA1 protein network | https://string-db.org/network/268739.Nmlp_2772 | ADP-ribose pyrophosphatase. |
| Nmlp_2773 protein network | https://string-db.org/network/268739.Nmlp_2773 | Uncharacterized protein. |
| Nmlp_2774 protein network | https://string-db.org/network/268739.Nmlp_2774 | Homolog to NAD kinase. |
| grx4 protein network | https://string-db.org/network/268739.Nmlp_2775 | Glutaredoxin. |
| tssA2 protein network | https://string-db.org/network/268739.Nmlp_2776 | Rhodanese domain protein. |
| tssA1 protein network | https://string-db.org/network/268739.Nmlp_2777 | Rhodanese domain protein. |
| Nmlp_2778 protein network | https://string-db.org/network/268739.Nmlp_2778 | Ferritin domain protein. |
| Nmlp_2779 protein network | https://string-db.org/network/268739.Nmlp_2779 | Uncharacterized protein. |
| Nmlp_2780 protein network | https://string-db.org/network/268739.Nmlp_2780 | IS1341-type transposase ISNamo26. |
| purM protein network | https://string-db.org/network/268739.Nmlp_2781 | Phosphoribosylformylglycinamidine cyclo-ligase. |
| Nmlp_2782 protein network | https://string-db.org/network/268739.Nmlp_2782 | M50 family metalloprotease. |
| Nmlp_2783 protein network | https://string-db.org/network/268739.Nmlp_2783 | TraB family protein. |
| Nmlp_2784 protein network | https://string-db.org/network/268739.Nmlp_2784 | UspA domain protein. |
| Nmlp_2785 protein network | https://string-db.org/network/268739.Nmlp_2785 | Uncharacterized protein. |
| Nmlp_2787 protein network | https://string-db.org/network/268739.Nmlp_2787 | Uncharacterized protein. |
| Nmlp_2788 protein network | https://string-db.org/network/268739.Nmlp_2788 | Uncharacterized protein. |
| Nmlp_2789 protein network | https://string-db.org/network/268739.Nmlp_2789 | UPF0098 family protein. |
| Nmlp_2790 protein network | https://string-db.org/network/268739.Nmlp_2790 | Uncharacterized protein. |
| Nmlp_2791 protein network | https://string-db.org/network/268739.Nmlp_2791 | Uncharacterized protein. |
| flaD protein network | https://string-db.org/network/268739.Nmlp_2792 | Fla cluster protein FlaD. |
| Nmlp_2793 protein network | https://string-db.org/network/268739.Nmlp_2793 | Rhodanese domain protein / beta-lactamase domain protein. |
| copA protein network | https://string-db.org/network/268739.Nmlp_2794 | P-type transport ATPase (probable substrate copper/metal cation). |
| Nmlp_2795 protein network | https://string-db.org/network/268739.Nmlp_2795 | Lrp/AsnC family transcription regulator. |
| Nmlp_2796 protein network | https://string-db.org/network/268739.Nmlp_2796 | DUF309 family protein. |
| Nmlp_2799 protein network | https://string-db.org/network/268739.Nmlp_2799 | DUF3006 family protein. |
| Nmlp_2800 protein network | https://string-db.org/network/268739.Nmlp_2800 | Uncharacterized protein. |
| suhB protein network | https://string-db.org/network/268739.Nmlp_2801 | Probable inositol-1(or 4)-monophosphatase / fructose-1,6-bisphosphatase, archaeal-type. |
| Nmlp_2802 protein network | https://string-db.org/network/268739.Nmlp_2802 | DUF63 family protein. |
| arsC2 protein network | https://string-db.org/network/268739.Nmlp_2803 | Arsenate reductase (glutaredoxin). |
| phoU4 protein network | https://string-db.org/network/268739.Nmlp_2804 | PhoU domain protein. |
| phoU3 protein network | https://string-db.org/network/268739.Nmlp_2805 | PhoU domain protein; Plays a role in the regulation of phosphate uptake. |
| pstB2 protein network | https://string-db.org/network/268739.Nmlp_2806 | ABC-type transport system ATP-binding protein (probable substrate phosphate); Part of the ABC transporter complex PstSACB involved in phosphate import. Responsible for energy coupling to the tran [...] |
| pstA1 protein network | https://string-db.org/network/268739.Nmlp_2807 | ABC-type transport system permease protein (probable substrate phosphate). |
| pstC2 protein network | https://string-db.org/network/268739.Nmlp_2808 | ABC-type transport system permease protein (probable substrate phosphate); Part of the binding-protein-dependent transport system for phosphate; probably responsible for the translocation of the [...] |
| pstS1 protein network | https://string-db.org/network/268739.Nmlp_2809 | ABC-type transport system periplasmic substrate-binding protein (probable substrate phosphate). |
| Nmlp_2810 protein network | https://string-db.org/network/268739.Nmlp_2810 | Uncharacterized protein. |
| Nmlp_2811 protein network | https://string-db.org/network/268739.Nmlp_2811 | Uncharacterized protein. |
| Nmlp_2812 protein network | https://string-db.org/network/268739.Nmlp_2812 | Uncharacterized protein. |
| Nmlp_2813 protein network | https://string-db.org/network/268739.Nmlp_2813 | DHH/RecJ family phosphoesterase. |
| Nmlp_2814 protein network | https://string-db.org/network/268739.Nmlp_2814 | PRC domain protein. |
| trxA3 protein network | https://string-db.org/network/268739.Nmlp_2815 | Thioredoxin. |
| Nmlp_2816 protein network | https://string-db.org/network/268739.Nmlp_2816 | DRTGG domain protein. |
| acdA protein network | https://string-db.org/network/268739.Nmlp_2817 | acetate--CoA ligase (ADP-forming). |
| znuB2 protein network | https://string-db.org/network/268739.Nmlp_2818 | ABC-type transport system permease protein (probable substrate zinc). |
| znuC2 protein network | https://string-db.org/network/268739.Nmlp_2818A | ABC-type transport system ATP-binding protein (probable substrate zinc). |
| znuA2 protein network | https://string-db.org/network/268739.Nmlp_2819 | ABC-type transport system periplasmic substrate-binding protein (probable substrate zinc). |
| ybaK protein network | https://string-db.org/network/268739.Nmlp_2820 | YbaK domain protein. |
| Nmlp_2821 protein network | https://string-db.org/network/268739.Nmlp_2821 | Beta-lactamase domain protein. |
| Nmlp_2822 protein network | https://string-db.org/network/268739.Nmlp_2822 | Uncharacterized protein. |
| trpB2 protein network | https://string-db.org/network/268739.Nmlp_2823 | Tryptophan synthase beta subunit; The beta subunit is responsible for the synthesis of L- tryptophan from indole and L-serine. |
| Nmlp_2824 protein network | https://string-db.org/network/268739.Nmlp_2824 | Probable oxidoreductase (short-chain dehydrogenase family); Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Nmlp_2825 protein network | https://string-db.org/network/268739.Nmlp_2825 | Probable secreted glycoprotein. |
| gufA1 protein network | https://string-db.org/network/268739.Nmlp_2826 | GufA family transport protein (probable substrate zinc). |
| Nmlp_2827 protein network | https://string-db.org/network/268739.Nmlp_2827 | Uncharacterized protein. |
| purD protein network | https://string-db.org/network/268739.Nmlp_2828 | Phosphoribosylamine--glycine ligase; Belongs to the GARS family. |
| Nmlp_2830 protein network | https://string-db.org/network/268739.Nmlp_2830 | Uncharacterized protein. |
| Nmlp_2831 protein network | https://string-db.org/network/268739.Nmlp_2831 | YyaL family protein. |
| gdhA protein network | https://string-db.org/network/268739.Nmlp_2833 | Glutamate dehydrogenase; Gene has frameshifts; locus_tag: Nmlp_2832; product: homolog to citrate lyase beta subunit (nonfunctional); conceptual translation after in silico reconstruction: MARRSVL [...] |
| tyrS protein network | https://string-db.org/network/268739.Nmlp_2837 | tyrosine--tRNA ligase. |
| Nmlp_2838 protein network | https://string-db.org/network/268739.Nmlp_2838 | Sensor box histidine kinase. |
| Nmlp_2840 protein network | https://string-db.org/network/268739.Nmlp_2840 | Uncharacterized protein; Product: HxlR family transcription regulator (nonfunctional). |
| bdhA2 protein network | https://string-db.org/network/268739.Nmlp_2841 | 3-hydroxybutyrate dehydrogenase. |
| moaA protein network | https://string-db.org/network/268739.Nmlp_2842 | Probable cyclic pyranopterin monophosphate synthase; Catalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate; Belongs to the radical SAM superfamily. MoaA family [...] |
| Nmlp_2843 protein network | https://string-db.org/network/268739.Nmlp_2843 | Homolog to phage PhiH1 repressor protein. |
| Nmlp_2844 protein network | https://string-db.org/network/268739.Nmlp_2844 | Uncharacterized protein. |
| pus10 protein network | https://string-db.org/network/268739.Nmlp_2845 | tRNA pseudouridine synthase Pus10; Responsible for synthesis of pseudouridine from uracil-54 and uracil-55 in the psi GC loop of transfer RNAs. |
| pmm3 protein network | https://string-db.org/network/268739.Nmlp_2846 | Phosphohexomutase (phosphoglucomutase / phosphomannomutase); Belongs to the phosphohexose mutase family. |
| Nmlp_2847 protein network | https://string-db.org/network/268739.Nmlp_2847 | Uncharacterized protein. |
| Nmlp_2848 protein network | https://string-db.org/network/268739.Nmlp_2848 | Uncharacterized protein. |
| Nmlp_2849 protein network | https://string-db.org/network/268739.Nmlp_2849 | Uncharacterized protein. |
| SpeE protein network | https://string-db.org/network/268739.Nmlp_2850 | Polyamine aminopropyltransferase. |
| Nmlp_2851 protein network | https://string-db.org/network/268739.Nmlp_2851 | Uncharacterized protein. |
| hemAT2 protein network | https://string-db.org/network/268739.Nmlp_2852 | Transducer protein HemAT. |
| Nmlp_2853 protein network | https://string-db.org/network/268739.Nmlp_2853 | Sensor box histidine kinase. |
| Nmlp_2854 protein network | https://string-db.org/network/268739.Nmlp_2854 | Sensor box histidine kinase. |
| Nmlp_2856 protein network | https://string-db.org/network/268739.Nmlp_2856 | UPF0212 family protein; Belongs to the UPF0212 family. |
| Nmlp_2857 protein network | https://string-db.org/network/268739.Nmlp_2857 | DNA N-glycosylase. |
| Nmlp_2858 protein network | https://string-db.org/network/268739.Nmlp_2858 | Uncharacterized protein. |
| Nmlp_2859 protein network | https://string-db.org/network/268739.Nmlp_2859 | Probable secreted glycoprotein. |
| acyP protein network | https://string-db.org/network/268739.Nmlp_2860 | Acylphosphatase. |
| nnrDE protein network | https://string-db.org/network/268739.Nmlp_2861 | Bifunctional NAD(P)H-hydrate repair enzyme Nnr; Bifunctional enzyme that catalyzes the epimerization of the S- and R-forms of NAD(P)HX and the dehydration of the S-form of NAD(P)HX at the expense [...] |
| moaC protein network | https://string-db.org/network/268739.Nmlp_2862 | Probable cyclic pyranopterin monophosphate synthase accessory protein; Catalyzes the conversion of (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP [...] |
| hflX protein network | https://string-db.org/network/268739.Nmlp_2863 | Ribosome-associating GTPase HflX; GTPase that associates with the 50S ribosomal subunit and may have a role during protein synthesis or ribosome biogenesis. Belongs to the TRAFAC class OBG-HflX-l [...] |
| cbs8 protein network | https://string-db.org/network/268739.Nmlp_2864 | HTH/CBS domain protein. |
| Nmlp_2865 protein network | https://string-db.org/network/268739.Nmlp_2865 | UPF0212 family protein; Belongs to the UPF0212 family. |
| psmB protein network | https://string-db.org/network/268739.Nmlp_2866 | Proteasome beta subunit; Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. |
| ligB protein network | https://string-db.org/network/268739.Nmlp_2867 | DNA ligase (ATP); DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. |
| Nmlp_2868 protein network | https://string-db.org/network/268739.Nmlp_2868 | Metal-dependent hydrolase domain protein. |
| Nmlp_2869 protein network | https://string-db.org/network/268739.Nmlp_2869 | Uncharacterized protein. |
| Nmlp_2870 protein network | https://string-db.org/network/268739.Nmlp_2870 | Uncharacterized protein. |
| Nmlp_2871 protein network | https://string-db.org/network/268739.Nmlp_2871 | Uncharacterized protein. |
| dna2 protein network | https://string-db.org/network/268739.Nmlp_2872 | ATP-dependent DNA helicase Dna2. |
| Nmlp_2873 protein network | https://string-db.org/network/268739.Nmlp_2873 | Uncharacterized protein. |
| Nmlp_2874 protein network | https://string-db.org/network/268739.Nmlp_2874 | Uncharacterized protein. |
| Nmlp_2875 protein network | https://string-db.org/network/268739.Nmlp_2875 | Small CPxCG-related zinc finger protein. |
| Nmlp_2876 protein network | https://string-db.org/network/268739.Nmlp_2876 | DUF2342 family protein. |
| grx3 protein network | https://string-db.org/network/268739.Nmlp_2877 | Glutaredoxin. |
| Nmlp_2878 protein network | https://string-db.org/network/268739.Nmlp_2878 | Uncharacterized protein. |
| Nmlp_2879 protein network | https://string-db.org/network/268739.Nmlp_2879 | Peroxiredoxin domain protein. |
| Nmlp_2880 protein network | https://string-db.org/network/268739.Nmlp_2880 | Family 3 CoA transferase; Gene has an in-frame stop codon and is truncated at the N-terminus; locus_tag: Nmlp_2879A; product: IS1341-type transposase NmIRS31 (nonfunctional). |
| Nmlp_2882 protein network | https://string-db.org/network/268739.Nmlp_2882 | UPF0324 family protein. |
| Nmlp_2883 protein network | https://string-db.org/network/268739.Nmlp_2883 | Probable rhomboid family protease. |
| Nmlp_2884 protein network | https://string-db.org/network/268739.Nmlp_2884 | Probable rRNA methyltransferase. |
| Nmlp_2885 protein network | https://string-db.org/network/268739.Nmlp_2885 | Uncharacterized protein. |
| tfbA3 protein network | https://string-db.org/network/268739.Nmlp_2886 | Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB). |
| deoC1 protein network | https://string-db.org/network/268739.Nmlp_2887 | Deoxyribose-phosphate aldolase. |
| Nmlp_2888 protein network | https://string-db.org/network/268739.Nmlp_2888 | MiaB-like tRNA modifying enzyme. |
| Nmlp_2889 protein network | https://string-db.org/network/268739.Nmlp_2889 | Transport protein (probable substrate zinc/cadmium/cobalt). |
| hit1 protein network | https://string-db.org/network/268739.Nmlp_2890 | Histidine triad family protein (homolog to bis(5'-nucleosyl)-tetraphosphatase). |
| Nmlp_2891 protein network | https://string-db.org/network/268739.Nmlp_2891 | Small CPxCG-related zinc finger protein. |
| fba1 protein network | https://string-db.org/network/268739.Nmlp_2892 | Fructose-bisphosphate aldolase, class 1. |
| fbp protein network | https://string-db.org/network/268739.Nmlp_2893 | Fructose-1,6-bisphosphatase. |
| Nmlp_2895 protein network | https://string-db.org/network/268739.Nmlp_2895 | Uncharacterized protein; Gene has a frameshift and is truncated at the C-terminus; locus_tag: Nmlp_2894; product: uncharacterized protein (nonfunctional). |
| Nmlp_2896 protein network | https://string-db.org/network/268739.Nmlp_2896 | Uncharacterized protein. |
| Nmlp_2897 protein network | https://string-db.org/network/268739.Nmlp_2897 | DUF460 domain protein. |
| cbs7 protein network | https://string-db.org/network/268739.Nmlp_2898 | CBS domain protein. |
| Nmlp_2899 protein network | https://string-db.org/network/268739.Nmlp_2899 | UspA domain protein. |
| Nmlp_2900 protein network | https://string-db.org/network/268739.Nmlp_2900 | UspA domain protein. |
| mscS1 protein network | https://string-db.org/network/268739.Nmlp_2902 | Mechanosensitive channel protein MscS; Product: UspA domain protein (nonfunctional). |
| Nmlp_2903 protein network | https://string-db.org/network/268739.Nmlp_2903 | CRM domain protein. |
| rnp4 protein network | https://string-db.org/network/268739.Nmlp_2904 | Ribonuclease P protein component 4; Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. |
| Nmlp_2905 protein network | https://string-db.org/network/268739.Nmlp_2905 | Uncharacterized protein. |
| pdaD protein network | https://string-db.org/network/268739.Nmlp_2906 | Pyruvoyl-dependent arginine decarboxylase. |
| Nmlp_2907 protein network | https://string-db.org/network/268739.Nmlp_2907 | Homolog to antitoxin VapB. |
| Nmlp_2912 protein network | https://string-db.org/network/268739.Nmlp_2912 | Homolog to UvrD/REP helicase; Product: uncharacterized protein (nonfunctional). |
| Nmlp_2913 protein network | https://string-db.org/network/268739.Nmlp_2913 | Uncharacterized protein. |
| Nmlp_2914 protein network | https://string-db.org/network/268739.Nmlp_2914 | UvrD/REP family helicase. |
| Nmlp_2918 protein network | https://string-db.org/network/268739.Nmlp_2918 | Gene has been targetted by a transposon; locus_tag: Nmlp_2917; product: IS1341-type transposase ISNamo20 (nonfunctional); conceptual translation after in silico reconstruction: MLEIHRTHRAKILNHNQV [...] |
| Nmlp_2920 protein network | https://string-db.org/network/268739.Nmlp_2920 | AAA-type ATPase domain protein; Product: ISH14-type transposase NmIRS20 (nonfunctional). |
| Nmlp_2921 protein network | https://string-db.org/network/268739.Nmlp_2921 | Uncharacterized protein. |
| Nmlp_2922 protein network | https://string-db.org/network/268739.Nmlp_2922 | Uncharacterized protein. |
| Nmlp_2923 protein network | https://string-db.org/network/268739.Nmlp_2923 | Adenine-specific DNA modification methylase. |
| Nmlp_2924 protein network | https://string-db.org/network/268739.Nmlp_2924 | DUF2204 family protein. |
| Nmlp_2925 protein network | https://string-db.org/network/268739.Nmlp_2925 | ArsR family transcription regulator. |
| Nmlp_2926 protein network | https://string-db.org/network/268739.Nmlp_2926 | DUF499 domain protein. |
| Nmlp_2927 protein network | https://string-db.org/network/268739.Nmlp_2927 | ATP-dependent helicase. |
| Nmlp_2928 protein network | https://string-db.org/network/268739.Nmlp_2928 | Uncharacterized protein. |
| Nmlp_2929 protein network | https://string-db.org/network/268739.Nmlp_2929 | XerC/D-like integrase. |
| Nmlp_2930 protein network | https://string-db.org/network/268739.Nmlp_2930 | Uncharacterized protein. |
| Nmlp_2934 protein network | https://string-db.org/network/268739.Nmlp_2934 | ISH18-type transposase NmIRS12; Gene is truncated at the C-terminus; product: ISH11-type transposase NmIRS11 (nonfunctional). |
| Nmlp_2935 protein network | https://string-db.org/network/268739.Nmlp_2935 | Coiled-coil protein. |
| ftsZ6 protein network | https://string-db.org/network/268739.Nmlp_2936 | FtsZ family protein, noncanonical. |
| Nmlp_2939 protein network | https://string-db.org/network/268739.Nmlp_2939 | Uncharacterized protein. |
| ftsZ7 protein network | https://string-db.org/network/268739.Nmlp_2940 | FtsZ family protein, noncanonical. |
| CCQ37088.1 protein network | https://string-db.org/network/268739.Nmlp_2940A | Uncharacterized protein. |
| Nmlp_2941 protein network | https://string-db.org/network/268739.Nmlp_2941 | Coiled-coil protein. |
| ftsZ8 protein network | https://string-db.org/network/268739.Nmlp_2945 | FtsZ family protein, noncanonical. |
| Nmlp_2946 protein network | https://string-db.org/network/268739.Nmlp_2946 | Uncharacterized protein. |
| Nmlp_2948 protein network | https://string-db.org/network/268739.Nmlp_2948 | Uncharacterized protein. |
| Nmlp_2949 protein network | https://string-db.org/network/268739.Nmlp_2949 | Probable secreted glycoprotein. |
| Nmlp_2950 protein network | https://string-db.org/network/268739.Nmlp_2950 | PQQ repeat protein. |
| Nmlp_2951 protein network | https://string-db.org/network/268739.Nmlp_2951 | AAA-type ATPase core domain protein; Belongs to the AAA ATPase family. |
| CCQ37096.1 protein network | https://string-db.org/network/268739.Nmlp_2951A | Uncharacterized protein. |
| Nmlp_2952 protein network | https://string-db.org/network/268739.Nmlp_2952 | Uncharacterized protein. |
| Nmlp_2953 protein network | https://string-db.org/network/268739.Nmlp_2953 | Uncharacterized protein. |
| ubiA2 protein network | https://string-db.org/network/268739.Nmlp_2958 | tRNA-Arg; Prenyltransferase that catalyzes the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C2 hydroxyl of (S)-3-O-geranylgeranylglyceryl phosphate (GGGP). Th [...] |
| Nmlp_2959 protein network | https://string-db.org/network/268739.Nmlp_2959 | YneT family protein. |
| Nmlp_2960 protein network | https://string-db.org/network/268739.Nmlp_2960 | Uncharacterized protein. |
| lpl2 protein network | https://string-db.org/network/268739.Nmlp_2961 | Lipoate-protein ligase domain protein. |
| Nmlp_2965 protein network | https://string-db.org/network/268739.Nmlp_2965 | Receiver box response regulator. |
| Nmlp_2966 protein network | https://string-db.org/network/268739.Nmlp_2966 | Receiver box HTH-10 family transcription regulator. |
| Nmlp_2967 protein network | https://string-db.org/network/268739.Nmlp_2967 | Sensor box histidine kinase. |
| Nmlp_2968 protein network | https://string-db.org/network/268739.Nmlp_2968 | HTH domain protein. |
| thrC3 protein network | https://string-db.org/network/268739.Nmlp_2969 | Threonine synthase. |
| htr34 protein network | https://string-db.org/network/268739.Nmlp_2970 | Transducer protein Htr34. |
| Nmlp_2971 protein network | https://string-db.org/network/268739.Nmlp_2971 | Uncharacterized protein. |
| Nmlp_2972 protein network | https://string-db.org/network/268739.Nmlp_2972 | Amine oxidase domain protein. |
| Nmlp_2973 protein network | https://string-db.org/network/268739.Nmlp_2973 | Cupin 2 barrel domain protein. |
| Nmlp_2974 protein network | https://string-db.org/network/268739.Nmlp_2974 | Probable phosphoesterase. |
| Nmlp_2975 protein network | https://string-db.org/network/268739.Nmlp_2975 | arNOG05395 family transcription regulator. |
| dapB protein network | https://string-db.org/network/268739.Nmlp_2976 | 4-hydroxy-tetrahydrodipicolinate reductase; Catalyzes the conversion of 4-hydroxy-tetrahydrodipicolinate (HTPA) to tetrahydrodipicolinate; Belongs to the DapB family. |
| dapA protein network | https://string-db.org/network/268739.Nmlp_2977 | 4-hydroxy-tetrahydrodipicolinate synthase; Catalyzes the condensation of (S)-aspartate-beta-semialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA). |
| Nmlp_2978 protein network | https://string-db.org/network/268739.Nmlp_2978 | TrkA-N domain protein. |
| Nmlp_2979 protein network | https://string-db.org/network/268739.Nmlp_2979 | Uncharacterized protein. |
| Nmlp_2980 protein network | https://string-db.org/network/268739.Nmlp_2980 | Uncharacterized protein. |
| Nmlp_2981 protein network | https://string-db.org/network/268739.Nmlp_2981 | NurA domain protein. |
| icd protein network | https://string-db.org/network/268739.Nmlp_2982 | Isocitrate dehydrogenase (NADP). |
| proS protein network | https://string-db.org/network/268739.Nmlp_2983 | proline--tRNA ligase; Catalyzes the attachment of proline to tRNA(Pro) in a two- step reaction: proline is first activated by ATP to form Pro-AMP and then transferred to the acceptor end of tRNA( [...] |
| Nmlp_2984 protein network | https://string-db.org/network/268739.Nmlp_2984 | Homolog to sulfate adenylyltransferase small subunit. |
| Nmlp_2985 protein network | https://string-db.org/network/268739.Nmlp_2985 | Uncharacterized protein. |
| Nmlp_2986 protein network | https://string-db.org/network/268739.Nmlp_2986 | Uncharacterized protein. |
| gltB protein network | https://string-db.org/network/268739.Nmlp_2987 | Glutamate synthase large subunit. |
| gcvH protein network | https://string-db.org/network/268739.Nmlp_2988 | Glycine cleavage system protein H; The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein. |
| Nmlp_2989 protein network | https://string-db.org/network/268739.Nmlp_2989 | DUF88 family protein. |
| Nmlp_2990 protein network | https://string-db.org/network/268739.Nmlp_2990 | Homolog to sodium/calcium antiporter. |
| Nmlp_2991 protein network | https://string-db.org/network/268739.Nmlp_2991 | Probable S-adenosylmethionine-dependent methyltransferase. |
| mpcT protein network | https://string-db.org/network/268739.Nmlp_2992 | Transducer protein MpcT. |
| lysA protein network | https://string-db.org/network/268739.Nmlp_2993 | Diaminopimelate decarboxylase; Specifically catalyzes the decarboxylation of meso- diaminopimelate (meso-DAP) to L-lysine. |
| deoC2 protein network | https://string-db.org/network/268739.Nmlp_2994 | Deoxyribose-phosphate aldolase; Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5- phosphate; Belongs to the DeoC/FbaB ald [...] |
| Nmlp_2995 protein network | https://string-db.org/network/268739.Nmlp_2995 | DUF4010 family protein. |
| purB protein network | https://string-db.org/network/268739.Nmlp_2996 | Adenylosuccinate lyase. |
| Nmlp_2997 protein network | https://string-db.org/network/268739.Nmlp_2997 | HAD superfamily hydrolase. |
| Nmlp_2998 protein network | https://string-db.org/network/268739.Nmlp_2998 | APH family phosphotransferase. |
| purNH protein network | https://string-db.org/network/268739.Nmlp_2999 | Phosphoribosylglycinamide formyltransferase / phosphoribosylaminoimidazolecarboxamide formyltransferase. |
| Tif2Ba protein network | https://string-db.org/network/268739.Nmlp_3000 | NUDIX family hydrolase / eIF-2B domain protein; Belongs to the eIF-2B alpha/beta/delta subunits family. |
| aglM protein network | https://string-db.org/network/268739.Nmlp_3001 | UDP-glucose 6-dehydrogenase AglM. |
| trmY protein network | https://string-db.org/network/268739.Nmlp_3002 | tRNA (pseudouridine(54)-N(1))-methyltransferase; Specifically catalyzes the N1-methylation of pseudouridine at position 54 (Psi54) in tRNAs; Belongs to the methyltransferase superfamily. TrmY fam [...] |
| Nmlp_3003 protein network | https://string-db.org/network/268739.Nmlp_3003 | Uncharacterized protein. |
| Nmlp_3004 protein network | https://string-db.org/network/268739.Nmlp_3004 | Small CPxCG-related zinc finger protein. |
| Nmlp_3005 protein network | https://string-db.org/network/268739.Nmlp_3005 | arNOG05179 family protein (DUF87-related AAA-type ATPase). |
| Nmlp_3006 protein network | https://string-db.org/network/268739.Nmlp_3006 | Uncharacterized protein; Product: IS1341-type transposase NmIRS61 (nonfunctional). |
| pyrB protein network | https://string-db.org/network/268739.Nmlp_3007 | Aspartate carbamoyltransferase catalytic subunit. |
| pyrI protein network | https://string-db.org/network/268739.Nmlp_3008 | Aspartate carbamoyltransferase regulatory subunit; Involved in allosteric regulation of aspartate carbamoyltransferase. |
| Nmlp_3009 protein network | https://string-db.org/network/268739.Nmlp_3009 | Glycoside hydrolase domain protein. |
| Nmlp_3010 protein network | https://string-db.org/network/268739.Nmlp_3010 | NUDIX family hydrolase. |
| Nmlp_3011 protein network | https://string-db.org/network/268739.Nmlp_3011 | DUF1918 family protein. |
| Nmlp_3012 protein network | https://string-db.org/network/268739.Nmlp_3012 | DUF54 family protein. |
| Nmlp_3013 protein network | https://string-db.org/network/268739.Nmlp_3013 | Uncharacterized protein. |
| cyc2 protein network | https://string-db.org/network/268739.Nmlp_3014 | Cytochrome P450. |
| Nmlp_3015 protein network | https://string-db.org/network/268739.Nmlp_3015 | Uncharacterized protein. |
| rad25c protein network | https://string-db.org/network/268739.Nmlp_3016 | DNA repair helicase Rad25. |
| yvoF protein network | https://string-db.org/network/268739.Nmlp_3017 | O-acetyltransferase (homolog to galactoside O-acetyltransferase). |
| Nmlp_3018 protein network | https://string-db.org/network/268739.Nmlp_3018 | Uncharacterized protein. |
| mscS2 protein network | https://string-db.org/network/268739.Nmlp_3019 | Mechanosensitive channel protein MscS. |
| dacZ protein network | https://string-db.org/network/268739.Nmlp_3020 | DisA-N domain protein; Diadenylate cyclase that catalyzes the condensation of 2 ATP molecules into cyclic di-AMP (c-di-AMP). c-di-AMP is a second messenger for intracellular signal transduction i [...] |
| nthA protein network | https://string-db.org/network/268739.Nmlp_3021 | Endonuclease 3; DNA repair enzyme that has both DNA N-glycosylase activity and AP-lyase activity. The DNA N-glycosylase activity releases various damaged pyrimidines from DNA by cleaving the N-gl [...] |
| Nmlp_3022 protein network | https://string-db.org/network/268739.Nmlp_3022 | NUDIX family hydrolase. |
| Nmlp_3023 protein network | https://string-db.org/network/268739.Nmlp_3023 | Uncharacterized protein. |
| sph2 protein network | https://string-db.org/network/268739.Nmlp_3024 | Smc-like protein Sph2. |
| Nmlp_3025 protein network | https://string-db.org/network/268739.Nmlp_3025 | Probable oxidoreductase (short-chain dehydrogenase family). |
| crtD protein network | https://string-db.org/network/268739.Nmlp_3026 | Carotenoid 3,4-desaturase. |
| lyeJ protein network | https://string-db.org/network/268739.Nmlp_3027 | Lycopene elongase / lycopene 1,2-hydratase. |
| cruF protein network | https://string-db.org/network/268739.Nmlp_3028 | Bisanhydrobacterioruberin hydratase. |
| crtB protein network | https://string-db.org/network/268739.Nmlp_3029 | Phytoene synthase. |
| rnhA1 protein network | https://string-db.org/network/268739.Nmlp_3030 | Ribonuclease H, type 1. |
| radB protein network | https://string-db.org/network/268739.Nmlp_3031 | DNA repair and recombination protein RadB; Involved in DNA repair and in homologous recombination. May regulate the cleavage reactions of the branch-structured DNA. Has a very weak ATPase activit [...] |
| Nmlp_3032 protein network | https://string-db.org/network/268739.Nmlp_3032 | Uncharacterized protein. |
| Nmlp_3033 protein network | https://string-db.org/network/268739.Nmlp_3033 | Purine nucleoside permease domain protein. |
| rps8e protein network | https://string-db.org/network/268739.Nmlp_3034 | 30S ribosomal protein S8e. |
| cmk1 protein network | https://string-db.org/network/268739.Nmlp_3035 | Cytidylate kinase. |
| Nmlp_3036 protein network | https://string-db.org/network/268739.Nmlp_3036 | Uncharacterized protein. |
| entB1 protein network | https://string-db.org/network/268739.Nmlp_3037 | Isochorismatase family protein. |
| Nmlp_3038 protein network | https://string-db.org/network/268739.Nmlp_3038 | YcgG family protein. |
| Nmlp_3039 protein network | https://string-db.org/network/268739.Nmlp_3039 | Uncharacterized protein. |
| Nmlp_3040 protein network | https://string-db.org/network/268739.Nmlp_3040 | Histidine kinase. |
| tatD protein network | https://string-db.org/network/268739.Nmlp_3041 | 3'-5' ssDNA/RNA exonuclease TatD. |
| Nmlp_3042 protein network | https://string-db.org/network/268739.Nmlp_3042 | GNAT family acetyltransferase. |
| Nmlp_3043 protein network | https://string-db.org/network/268739.Nmlp_3043 | YdjM family protein. |
| Nmlp_3044 protein network | https://string-db.org/network/268739.Nmlp_3044 | YdjM family protein. |
| Nmlp_3045 protein network | https://string-db.org/network/268739.Nmlp_3045 | cro/C1 family transcription regulator. |
| Nmlp_3046 protein network | https://string-db.org/network/268739.Nmlp_3046 | Probable oxidoreductase (aldo-keto reductase family protein). |
| pduO protein network | https://string-db.org/network/268739.Nmlp_3047 | ATP:cob(I)alamin adenosyltransferase. |
| Nmlp_3048 protein network | https://string-db.org/network/268739.Nmlp_3048 | FAD-dependent oxidoreductase (homolog to geranylgeranyl reductase). |
| Nmlp_3049 protein network | https://string-db.org/network/268739.Nmlp_3049 | Product: uncharacterized protein (nonfunctional). |
| Nmlp_3050 protein network | https://string-db.org/network/268739.Nmlp_3050 | FAD-dependent oxidoreductase (GlcD/DLD_GlcF/GlpC domain fusion protein). |
| Nmlp_3051 protein network | https://string-db.org/network/268739.Nmlp_3051 | Uncharacterized protein. |
| Nmlp_3052 protein network | https://string-db.org/network/268739.Nmlp_3052 | Uncharacterized protein. |
| Nmlp_3053 protein network | https://string-db.org/network/268739.Nmlp_3053 | Uncharacterized protein. |
| rpl1 protein network | https://string-db.org/network/268739.Nmlp_3054 | 50S ribosomal protein L1; Binds directly to 23S rRNA. Probably involved in E site tRNA release. |
| rpl10 protein network | https://string-db.org/network/268739.Nmlp_3055 | 50S ribosomal protein L10; Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors. Belongs to the universal ribosomal prot [...] |
| rpl12 protein network | https://string-db.org/network/268739.Nmlp_3056 | 50S ribosomal protein L12; Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors. Belongs to the eukaryotic ribosomal pro [...] |
| Nmlp_3057 protein network | https://string-db.org/network/268739.Nmlp_3057 | DUF112 family protein. |
| cysS protein network | https://string-db.org/network/268739.Nmlp_3058 | cysteine--tRNA ligase. |
| Nmlp_3059 protein network | https://string-db.org/network/268739.Nmlp_3059 | Uncharacterized protein. |
| cbiX2 protein network | https://string-db.org/network/268739.Nmlp_3060 | Sirohydrochlorin cobaltochelatase. |
| Nmlp_3061 protein network | https://string-db.org/network/268739.Nmlp_3061 | Uncharacterized protein. |
| Nmlp_3062 protein network | https://string-db.org/network/268739.Nmlp_3062 | Uncharacterized protein. |
| Nmlp_3063 protein network | https://string-db.org/network/268739.Nmlp_3063 | UPF0434 family protein. |
| Nmlp_3064 protein network | https://string-db.org/network/268739.Nmlp_3064 | DUF123 domain protein. |
| Nmlp_3065 protein network | https://string-db.org/network/268739.Nmlp_3065 | DMT superfamily transport protein. |
| Nmlp_3066 protein network | https://string-db.org/network/268739.Nmlp_3066 | START domain protein. |
| Nmlp_3067 protein network | https://string-db.org/network/268739.Nmlp_3067 | Lrp/AsnC family transcription regulator. |
| rpc34 protein network | https://string-db.org/network/268739.Nmlp_3068 | Probable transcription factor (homolog to RNA polymerase III subunit RPC34). |
| Nmlp_3069 protein network | https://string-db.org/network/268739.Nmlp_3069 | NRDE domain protein. |
| menE protein network | https://string-db.org/network/268739.Nmlp_3070 | o-succinylbenzoate--CoA ligase. |
| menC protein network | https://string-db.org/network/268739.Nmlp_3071 | O-succinylbenzoate synthase; Converts 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylate (SHCHC) to 2-succinylbenzoate (OSB). |
| menA protein network | https://string-db.org/network/268739.Nmlp_3072 | 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Conversion of 1,4-dihydroxy-2-naphthoate (DHNA) to demethylmenaquinone (DMK); Belongs to the MenA family. Type 1 subfamily. |
| menB protein network | https://string-db.org/network/268739.Nmlp_3073 | 1,4-dihydroxy-2-naphthoyl-CoA synthase; Converts o-succinylbenzoyl-CoA (OSB-CoA) to 1,4-dihydroxy-2- naphthoyl-CoA (DHNA-CoA); Belongs to the enoyl-CoA hydratase/isomerase family. MenB subfamily. |
| Nmlp_3075 protein network | https://string-db.org/network/268739.Nmlp_3075 | DUF2892 family protein. |
| mscS3 protein network | https://string-db.org/network/268739.Nmlp_3076 | Mechanosensitive channel protein MscS. |
| Nmlp_3077 protein network | https://string-db.org/network/268739.Nmlp_3077 | DUF181 family protein. |
| Nmlp_3078 protein network | https://string-db.org/network/268739.Nmlp_3078 | Uncharacterized protein. |
| glyA protein network | https://string-db.org/network/268739.Nmlp_3079 | Serine hydroxymethyltransferase; Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. Also exhibits THF-independent aldola [...] |
| Nmlp_3080 protein network | https://string-db.org/network/268739.Nmlp_3080 | DoxX domain protein. |
| Nmlp_3081 protein network | https://string-db.org/network/268739.Nmlp_3081 | Flavin-dependent pyridine nucleotide oxidoreductase (homolog to coenzyme A disulfide reductase). |
| folD protein network | https://string-db.org/network/268739.Nmlp_3082 | Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase; Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolys [...] |
| Nmlp_3083 protein network | https://string-db.org/network/268739.Nmlp_3083 | NUDIX family hydrolase. |
| Nmlp_3084 protein network | https://string-db.org/network/268739.Nmlp_3084 | Uncharacterized protein. |
| ansB protein network | https://string-db.org/network/268739.Nmlp_3085 | Asparaginase/glutaminase family protein. |
| Nmlp_3086 protein network | https://string-db.org/network/268739.Nmlp_3086 | Uncharacterized protein. |
| Nmlp_3087 protein network | https://string-db.org/network/268739.Nmlp_3087 | PadR family transcription regulator. |
| Nmlp_3088 protein network | https://string-db.org/network/268739.Nmlp_3088 | DUF357 family protein. |
| trm5 protein network | https://string-db.org/network/268739.Nmlp_3089 | tRNA (guanine(37)-N(1))-methyltransferase. |
| Nmlp_3090 protein network | https://string-db.org/network/268739.Nmlp_3090 | DUF2298 family protein. |
| btuD protein network | https://string-db.org/network/268739.Nmlp_3091 | ABC-type transport system ATP-binding protein (probable substrate cobalamin). |
| btuC protein network | https://string-db.org/network/268739.Nmlp_3092 | ABC-type transport system permease protein (probable substrate cobalamin). |
| btuF protein network | https://string-db.org/network/268739.Nmlp_3093 | ABC-type transport system periplasmic substrate-binding protein (probable substrate cobalamin). |
| srp19 protein network | https://string-db.org/network/268739.Nmlp_3094 | Signal recognition particle 19K protein; Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kD [...] |
| gar1 protein network | https://string-db.org/network/268739.Nmlp_3095 | tRNA/rRNA pseudouridine synthase complex protein Gar1. |
| Nmlp_3096 protein network | https://string-db.org/network/268739.Nmlp_3096 | DUF1119 family protein. |
| Nmlp_3097 protein network | https://string-db.org/network/268739.Nmlp_3097 | Homolog to ornithine cyclodeaminase. |
| korB2 protein network | https://string-db.org/network/268739.Nmlp_3098 | Oxoglutarate--ferredoxin oxidoreductase beta subunit. |
| Nmlp_3099 protein network | https://string-db.org/network/268739.Nmlp_3099 | Uncharacterized protein. |
| sufB3 protein network | https://string-db.org/network/268739.Nmlp_3100 | SufB domain protein. |
| Nmlp_3101 protein network | https://string-db.org/network/268739.Nmlp_3101 | Uncharacterized protein; Gene has an insert and is truncated at the N-terminus; product: IS1341-type transposase NmIRS67 (nonfunctional); locus_tag: Nmlp_3100A. |
| trxB1 protein network | https://string-db.org/network/268739.Nmlp_3102 | Thioredoxin-disulfide reductase. |
| Nmlp_3103 protein network | https://string-db.org/network/268739.Nmlp_3103 | RND superfamily permease. |
| Nmlp_3104 protein network | https://string-db.org/network/268739.Nmlp_3104 | Uncharacterized protein. |
| Nmlp_3106 protein network | https://string-db.org/network/268739.Nmlp_3106 | Uncharacterized protein; Gene has an in-frame stop codon and lacks a start; locus_tag: Nmlp_3105; product: UspA domain protein (nonfunctional); conceptual translation after in silico reconstructi [...] |
| Nmlp_3107 protein network | https://string-db.org/network/268739.Nmlp_3107 | Uncharacterized protein. |
| Nmlp_3108 protein network | https://string-db.org/network/268739.Nmlp_3108 | Uncharacterized protein. |
| Nmlp_3109 protein network | https://string-db.org/network/268739.Nmlp_3109 | Uncharacterized protein. |
| Nmlp_3110 protein network | https://string-db.org/network/268739.Nmlp_3110 | GTP cyclohydrolase 1 domain protein. |
| gldA protein network | https://string-db.org/network/268739.Nmlp_3111 | Glycerol-1-phosphate dehydrogenase (NAD(P)); Catalyzes the NAD(P)H-dependent reduction of dihydroxyacetonephosphate (DHAP or glycerone phosphate) to glycerol 1- phosphate (G1P). The G1P thus gene [...] |
| Nmlp_3112 protein network | https://string-db.org/network/268739.Nmlp_3112 | GalE family epimerase/dehydratase. |
| cetZ2 protein network | https://string-db.org/network/268739.Nmlp_3115 | Tubulin-like protein CetZ; Involved in cell shape control; Belongs to the CetZ family. |
| cetZ3 protein network | https://string-db.org/network/268739.Nmlp_3116 | FtsZ family protein CetZ, type III; Involved in cell shape control; Belongs to the CetZ family. |
| Nmlp_3117 protein network | https://string-db.org/network/268739.Nmlp_3117 | Uncharacterized protein. |
| Nmlp_3118 protein network | https://string-db.org/network/268739.Nmlp_3118 | Receiver box response regulator. |
| Nmlp_3119 protein network | https://string-db.org/network/268739.Nmlp_3119 | Sensor/bat box HTH-10 family transcription regulator. |
| Nmlp_3120 protein network | https://string-db.org/network/268739.Nmlp_3120 | Histidine kinase. |
| Nmlp_3121 protein network | https://string-db.org/network/268739.Nmlp_3121 | Uncharacterized protein. |
| Nmlp_3122 protein network | https://string-db.org/network/268739.Nmlp_3122 | ArsR family transcription regulator. |
| acaB3 protein network | https://string-db.org/network/268739.Nmlp_3125 | acetyl-CoA C-acyltransferase. |
| Nmlp_3126 protein network | https://string-db.org/network/268739.Nmlp_3126 | DUF35 family protein. |
| acs1 protein network | https://string-db.org/network/268739.Nmlp_3127 | acyl-CoA synthetase. |
| Nmlp_3128 protein network | https://string-db.org/network/268739.Nmlp_3128 | TrkA-N domain protein. |
| Nmlp_3129 protein network | https://string-db.org/network/268739.Nmlp_3129 | Amidohydrolase domain protein. |
| maoC1 protein network | https://string-db.org/network/268739.Nmlp_3130 | MaoC domain protein. |
| mmcA1 protein network | https://string-db.org/network/268739.Nmlp_3131 | methylmalonyl-CoA mutase subunit A. |
| hbd protein network | https://string-db.org/network/268739.Nmlp_3132 | 3-hydroxyacyl-CoA dehydrogenase. |
| acd3 protein network | https://string-db.org/network/268739.Nmlp_3133 | acyl-CoA dehydrogenase. |
| Nmlp_3134 protein network | https://string-db.org/network/268739.Nmlp_3134 | IclR family transcription regulator. |
| folCP protein network | https://string-db.org/network/268739.Nmlp_3136 | Folylpolyglutamate synthase / 7,8-dihydropteroate reductase / dihydropteroate synthase. |
| gth3 protein network | https://string-db.org/network/268739.Nmlp_3137 | Probable glycosyltransferase, type 1. |
| Nmlp_3140 protein network | https://string-db.org/network/268739.Nmlp_3140 | GNAT family acetyltransferase; Product: peptidase S9 family protein (nonfunctional). |
| Nmlp_3141 protein network | https://string-db.org/network/268739.Nmlp_3141 | Uncharacterized protein. |
| Nmlp_3142 protein network | https://string-db.org/network/268739.Nmlp_3142 | Receiver/sensor box histidine kinase. |
| rfcB protein network | https://string-db.org/network/268739.Nmlp_3143 | Replication factor C large subunit; Part of the RFC clamp loader complex which loads the PCNA sliding clamp onto DNA; Belongs to the activator 1 small subunits family. RfcL subfamily. |
| Nmlp_3144 protein network | https://string-db.org/network/268739.Nmlp_3144 | ABC-type transport system ATP-binding protein (probable substrate glutamine/glutamate/polar amino acids). |
| Nmlp_3145 protein network | https://string-db.org/network/268739.Nmlp_3145 | ABC-type transport system permease protein (probable substrate glutamine/glutamate/polar amino acids). |
| Nmlp_3146 protein network | https://string-db.org/network/268739.Nmlp_3146 | ABC-type transport system periplasmic substrate-binding protein (probable substrate glutamine/glutamate/polar amino acids). |
| maeB2 protein network | https://string-db.org/network/268739.Nmlp_3147 | Malate dehydrogenase (oxaloacetate-decarboxylating). |
| Nmlp_3148 protein network | https://string-db.org/network/268739.Nmlp_3148 | IS1341-type transposase ISNamo20. |
| ctaA protein network | https://string-db.org/network/268739.Nmlp_3149 | Heme A synthase. |
| cad protein network | https://string-db.org/network/268739.Nmlp_3150 | Probable pterin-4-alpha-carbinolamine dehydratase. |
| Nmlp_3151 protein network | https://string-db.org/network/268739.Nmlp_3151 | Uncharacterized protein. |
| Nmlp_3152 protein network | https://string-db.org/network/268739.Nmlp_3152 | DUF2240 family protein. |
| Nmlp_3153 protein network | https://string-db.org/network/268739.Nmlp_3153 | Uncharacterized protein. |
| Nmlp_3154 protein network | https://string-db.org/network/268739.Nmlp_3154 | HAD superfamily hydrolase. |
| pyrF protein network | https://string-db.org/network/268739.Nmlp_3155 | Orotidine-5'-phosphate decarboxylase; Belongs to the OMP decarboxylase family. Type 2 subfamily. |
| Nmlp_3156 protein network | https://string-db.org/network/268739.Nmlp_3156 | NP_1176A family transcription regulator. |
| Nmlp_3157 protein network | https://string-db.org/network/268739.Nmlp_3157 | ISHwa16-type transposase ISNamo15. |
| Nmlp_3159 protein network | https://string-db.org/network/268739.Nmlp_3159 | Uncharacterized protein. |
| cheC2 protein network | https://string-db.org/network/268739.Nmlp_3160 | Taxis cluster protein CheC. |
| cysK protein network | https://string-db.org/network/268739.Nmlp_3161 | Cysteine synthase. |
| Nmlp_3162 protein network | https://string-db.org/network/268739.Nmlp_3162 | PaaY family protein. |
| Nmlp_3163 protein network | https://string-db.org/network/268739.Nmlp_3163 | Receiver box response regulator. |
| leuA1 protein network | https://string-db.org/network/268739.Nmlp_3165 | Uncharacterized protein; Product: 2-isopropylmalate synthase (nonfunctional). |
| ilvB protein network | https://string-db.org/network/268739.Nmlp_3166 | Acetolactate synthase large subunit. |
| ilvN protein network | https://string-db.org/network/268739.Nmlp_3167 | Acetolactate synthase small subunit. |
| ilvC protein network | https://string-db.org/network/268739.Nmlp_3168 | Ketol-acid reductoisomerase; Involved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol-acid reduction of (S)-2-acetolactate (S2AL) to yie [...] |
| Nmlp_3169 protein network | https://string-db.org/network/268739.Nmlp_3169 | Uncharacterized protein. |
| leuC protein network | https://string-db.org/network/268739.Nmlp_3170 | 3-isopropylmalate dehydratase large subunit; Catalyzes the isomerization between 2-isopropylmalate and 3- isopropylmalate, via the formation of 2-isopropylmaleate. |
| leuD protein network | https://string-db.org/network/268739.Nmlp_3171 | 3-isopropylmalate dehydratase small subunit. |
| leuB protein network | https://string-db.org/network/268739.Nmlp_3172 | 3-isopropylmalate dehydrogenase. |
| Nmlp_3173 protein network | https://string-db.org/network/268739.Nmlp_3173 | Uncharacterized protein. |
| Nmlp_3174 protein network | https://string-db.org/network/268739.Nmlp_3174 | OsmC domain protein. |
| Nmlp_3175 protein network | https://string-db.org/network/268739.Nmlp_3175 | Metal-dependent hydrolase domain protein; Belongs to the UPF0173 family. |
| Nmlp_3176 protein network | https://string-db.org/network/268739.Nmlp_3176 | GNAT family acetyltransferase. |
| Nmlp_3177 protein network | https://string-db.org/network/268739.Nmlp_3177 | Fumarylacetoacetase family protein. |
| Nmlp_3178 protein network | https://string-db.org/network/268739.Nmlp_3178 | Uncharacterized protein. |
| mobA1 protein network | https://string-db.org/network/268739.Nmlp_3179 | Molybdenum cofactor guanylyltransferase; Transfers a GMP moiety from GTP to Mo-molybdopterin (Mo-MPT) cofactor (Moco or molybdenum cofactor) to form Mo-molybdopterin guanine dinucleotide (Mo-MGD) [...] |
| hisC protein network | https://string-db.org/network/268739.Nmlp_3180 | Histidinol-phosphate aminotransferase. |
| adk2 protein network | https://string-db.org/network/268739.Nmlp_3181 | Probable adenylate kinase; Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and mono [...] |
| agsA protein network | https://string-db.org/network/268739.Nmlp_3182 | Probable archaetidylglycerolphosphate synthase; Belongs to the CDP-alcohol phosphatidyltransferase class-I family. |
| Nmlp_3183 protein network | https://string-db.org/network/268739.Nmlp_3183 | cro/C1 family transcription regulator. |
| Nmlp_3184 protein network | https://string-db.org/network/268739.Nmlp_3184 | Uncharacterized protein. |
| Nmlp_3185 protein network | https://string-db.org/network/268739.Nmlp_3185 | Uncharacterized protein. |
| flaCE protein network | https://string-db.org/network/268739.Nmlp_3186 | Fla cluster protein FlaCE. |
| flaH protein network | https://string-db.org/network/268739.Nmlp_3187 | Fla cluster protein FlaH. |
| flaI protein network | https://string-db.org/network/268739.Nmlp_3188 | Flagellar motor/biogenesis protein FlaI. |
| flaJ protein network | https://string-db.org/network/268739.Nmlp_3189 | Flagellar motor/biogenesis protein FlaJ. |
| cheF2 protein network | https://string-db.org/network/268739.Nmlp_3190 | Taxis protein CheF2. |
| rpe protein network | https://string-db.org/network/268739.Nmlp_3191 | Rpa-associated phosphoesterase. |
| rpap1 protein network | https://string-db.org/network/268739.Nmlp_3192 | Rpa-associated protein. |
| rpa1 protein network | https://string-db.org/network/268739.Nmlp_3193 | Replication protein A. |
| Nmlp_3194 protein network | https://string-db.org/network/268739.Nmlp_3194 | Probable DEAD/DEAH box helicase. |
| Nmlp_3195 protein network | https://string-db.org/network/268739.Nmlp_3195 | Ribonuclease H domain protein. |
| trxA5 protein network | https://string-db.org/network/268739.Nmlp_3196 | Thioredoxin. |
| cheD protein network | https://string-db.org/network/268739.Nmlp_3197 | Taxis cluster protein CheD; Probably deamidates glutamine residues to glutamate on methyl-accepting chemotaxis receptors (MCPs), playing an important role in chemotaxis; Belongs to the CheD famil [...] |
| cheC1 protein network | https://string-db.org/network/268739.Nmlp_3198 | Taxis cluster protein CheC. |
| cheY1 protein network | https://string-db.org/network/268739.Nmlp_3199 | Response regulator CheY. |
| Nmlp_3200 protein network | https://string-db.org/network/268739.Nmlp_3200 | Uncharacterized protein. |
| flaG2 protein network | https://string-db.org/network/268739.Nmlp_3201 | Fla cluster protein FlaG. |
| flaG1 protein network | https://string-db.org/network/268739.Nmlp_3202 | Fla cluster protein FlaG. |
| flaF protein network | https://string-db.org/network/268739.Nmlp_3203 | Fla cluster protein FlaF. |
| Nmlp_3204 protein network | https://string-db.org/network/268739.Nmlp_3204 | DUF217 family protein. |
| Nmlp_3205 protein network | https://string-db.org/network/268739.Nmlp_3205 | HTH domain protein. |
| flg3 protein network | https://string-db.org/network/268739.Nmlp_3208 | Flagellin; Flagellin is the subunit protein which polymerizes to form the filaments of archaeal flagella. |
| flg2 protein network | https://string-db.org/network/268739.Nmlp_3209 | Flagellin; Flagellin is the subunit protein which polymerizes to form the filaments of archaeal flagella. |
| flg1 protein network | https://string-db.org/network/268739.Nmlp_3210 | Flagellin; Flagellin is the subunit protein which polymerizes to form the filaments of archaeal flagella. |
| dpsA2 protein network | https://string-db.org/network/268739.Nmlp_3211 | ferritin/Dps domain protein. |
| ccdA protein network | https://string-db.org/network/268739.Nmlp_3212 | Cytochrome c-type biogenesis protein CcdA. |
| Nmlp_3213 protein network | https://string-db.org/network/268739.Nmlp_3213 | Cytochrome c family protein. |
| Nmlp_3214 protein network | https://string-db.org/network/268739.Nmlp_3214 | Thioredoxin domain protein. |
| ccmF2 protein network | https://string-db.org/network/268739.Nmlp_3215 | Cytochrome c-type biogenesis protein CcmF. |
| Nmlp_3216 protein network | https://string-db.org/network/268739.Nmlp_3216 | Uncharacterized protein. |
| phr4 protein network | https://string-db.org/network/268739.Nmlp_3217 | Cryptochrome/photolyase-related protein. |
| hcp1 protein network | https://string-db.org/network/268739.Nmlp_3218 | Halocyanin. |
| Nmlp_3219 protein network | https://string-db.org/network/268739.Nmlp_3219 | uracil-DNA glycosylase superfamily protein. |
| Nmlp_3220 protein network | https://string-db.org/network/268739.Nmlp_3220 | Uncharacterized protein. |
| crcB1 protein network | https://string-db.org/network/268739.Nmlp_3221 | Putative fluoride ion transport protein CrcB; Important for reducing fluoride concentration in the cell, thus reducing its toxicity; Belongs to the CrcB (TC 9.B.71) family. |
| crcB2 protein network | https://string-db.org/network/268739.Nmlp_3222 | Putative fluoride ion transport protein CrcB; Important for reducing fluoride concentration in the cell, thus reducing its toxicity; Belongs to the CrcB (TC 9.B.71) family. |
| Nmlp_3223 protein network | https://string-db.org/network/268739.Nmlp_3223 | Receiver box response regulator. |
| rpl40e protein network | https://string-db.org/network/268739.Nmlp_3224 | 50S ribosomal protein L40e; Belongs to the eukaryotic ribosomal protein eL40 family. |
| srp54 protein network | https://string-db.org/network/268739.Nmlp_3225 | Signal recognition particle 54K protein; Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-n [...] |
| Nmlp_3226 protein network | https://string-db.org/network/268739.Nmlp_3226 | Receiver box response regulator. |
| Nmlp_3227 protein network | https://string-db.org/network/268739.Nmlp_3227 | Uncharacterized protein. |
| Nmlp_3228 protein network | https://string-db.org/network/268739.Nmlp_3228 | ABC-type transport system ATP-binding protein (probable substrate macrolides). |
| Nmlp_3229 protein network | https://string-db.org/network/268739.Nmlp_3229 | ABC-type transport system permease protein (probable substrate macrolides). |
| birA protein network | https://string-db.org/network/268739.Nmlp_3230 | HTH domain protein / biotin--[acetyl-CoA-carboxylase] ligase. |
| Nmlp_3231 protein network | https://string-db.org/network/268739.Nmlp_3231 | UspA domain protein. |
| GuaD2 protein network | https://string-db.org/network/268739.Nmlp_3232 | Amidohydrolase domain protein. |
| gptA protein network | https://string-db.org/network/268739.Nmlp_3234 | Probable phosphoribosyltransferase; Product: IS1341-type transposase NmIRS73 (nonfunctional). |
| qor3 protein network | https://string-db.org/network/268739.Nmlp_3235 | NADPH:quinone reductase. |
| phzF protein network | https://string-db.org/network/268739.Nmlp_3236 | PhzF family protein. |
| ppsA protein network | https://string-db.org/network/268739.Nmlp_3237 | Phosphoenolpyruvate synthase; Catalyzes the phosphorylation of pyruvate to phosphoenolpyruvate; Belongs to the PEP-utilizing enzyme family. |
| panD protein network | https://string-db.org/network/268739.Nmlp_3238 | Aspartate 1-decarboxylase; Catalyzes the decarboxylation of L-aspartate to produce beta- alanine; Belongs to the group II decarboxylase family. MfnA subfamily. |
| metS protein network | https://string-db.org/network/268739.Nmlp_3239 | methionine--tRNA ligase; Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation. |
| Nmlp_3240 protein network | https://string-db.org/network/268739.Nmlp_3240 | Uncharacterized protein. |
| Nmlp_3241 protein network | https://string-db.org/network/268739.Nmlp_3241 | NfeD domain protein. |
| Nmlp_3242 protein network | https://string-db.org/network/268739.Nmlp_3242 | Probable oxidoreductase (short-chain dehydrogenase family); Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| ths3 protein network | https://string-db.org/network/268739.Nmlp_3245 | Thermosome subunit 3; Belongs to the TCP-1 chaperonin family. |
| gtl4 protein network | https://string-db.org/network/268739.Nmlp_3246 | Probable glycosyltransferase, type 2. |
| Nmlp_3247 protein network | https://string-db.org/network/268739.Nmlp_3247 | Probable S-adenosylmethionine-dependent methyltransferase. |
| Nmlp_3248 protein network | https://string-db.org/network/268739.Nmlp_3248 | NP_1176A family transcription regulator. |
| pncB protein network | https://string-db.org/network/268739.Nmlp_3249 | Nicotinate phosphoribosyltransferase. |
| rio1 protein network | https://string-db.org/network/268739.Nmlp_3250 | RIO-type serine/threonine protein kinase Rio1. |
| citZ protein network | https://string-db.org/network/268739.Nmlp_3251 | Citrate synthase. |
| Nmlp_3252 protein network | https://string-db.org/network/268739.Nmlp_3252 | AstE domain protein. |
| tiaS protein network | https://string-db.org/network/268739.Nmlp_3253 | tRNA(Ile2) 2-agmatinylcytidine synthetase TiaS; ATP-dependent agmatine transferase that catalyzes the formation of 2-agmatinylcytidine (agm2C) at the wobble position (C34) of tRNA(Ile2), converti [...] |
| Nmlp_3254 protein network | https://string-db.org/network/268739.Nmlp_3254 | cro/C1 family transcription regulator. |
| Nmlp_3255 protein network | https://string-db.org/network/268739.Nmlp_3255 | Uncharacterized protein. |
| Nmlp_3256 protein network | https://string-db.org/network/268739.Nmlp_3256 | AAA-type ATPase (MoxR subfamily). |
| Nmlp_3257 protein network | https://string-db.org/network/268739.Nmlp_3257 | Uncharacterized protein. |
| Nmlp_3258 protein network | https://string-db.org/network/268739.Nmlp_3258 | Uncharacterized protein. |
| Nmlp_3259 protein network | https://string-db.org/network/268739.Nmlp_3259 | Von Willebrand factor type A domain protein. |
| Nmlp_3260 protein network | https://string-db.org/network/268739.Nmlp_3260 | Uncharacterized protein. |
| sod protein network | https://string-db.org/network/268739.Nmlp_3261 | Superoxide dismutase (Mn); Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Belongs to the iron/manganese superoxide dismutase family. |
| Nmlp_3262 protein network | https://string-db.org/network/268739.Nmlp_3262 | Uncharacterized protein. |
| phr2 protein network | https://string-db.org/network/268739.Nmlp_3263 | Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. |
| porB protein network | https://string-db.org/network/268739.Nmlp_3264 | Pyruvate--ferredoxin oxidoreductase beta subunit. |
| porA protein network | https://string-db.org/network/268739.Nmlp_3265 | Pyruvate--ferredoxin oxidoreductase alpha subunit. |
| Nmlp_3266 protein network | https://string-db.org/network/268739.Nmlp_3266 | Oxidoreductase (homolog to zinc-containing alcohol dehydrogenase). |
| Nmlp_3267 protein network | https://string-db.org/network/268739.Nmlp_3267 | DICT domain protein. |
| ahbB protein network | https://string-db.org/network/268739.Nmlp_3268 | Siroheme decarboxylase AhbB. |
| sirC protein network | https://string-db.org/network/268739.Nmlp_3269 | Precorrin-2 oxidase / ferrochelatase. |
| hemA protein network | https://string-db.org/network/268739.Nmlp_3270 | glutamyl-tRNA reductase; Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA). |
| cbs1 protein network | https://string-db.org/network/268739.Nmlp_3271 | CBS domain protein. |
| carB protein network | https://string-db.org/network/268739.Nmlp_3272 | Carbamoyl-phosphate synthase (glutamine-hydrolyzing) large subunit; Belongs to the CarB family. |
| Nmlp_3273 protein network | https://string-db.org/network/268739.Nmlp_3273 | Sensor box histidine kinase. |
| Nmlp_3274 protein network | https://string-db.org/network/268739.Nmlp_3274 | Cupin 2 barrel domain protein. |
| CinA2 protein network | https://string-db.org/network/268739.Nmlp_3275 | ADP-ribose pyrophosphatase. |
| Nmlp_3276 protein network | https://string-db.org/network/268739.Nmlp_3276 | Uncharacterized protein. |
| Nmlp_3277 protein network | https://string-db.org/network/268739.Nmlp_3277 | Uncharacterized protein. |
| hisI protein network | https://string-db.org/network/268739.Nmlp_3279 | phosphoribosyl-AMP cyclohydrolase; Catalyzes the hydrolysis of the adenine ring of phosphoribosyl-AMP. |
| Nmlp_3280 protein network | https://string-db.org/network/268739.Nmlp_3280 | Uncharacterized protein. |
| pmm1 protein network | https://string-db.org/network/268739.Nmlp_3281 | Phosphohexomutase (phosphoglucomutase / phosphomannomutase); Belongs to the phosphohexose mutase family. |
| Nmlp_3282 protein network | https://string-db.org/network/268739.Nmlp_3282 | Uncharacterized protein. |
| Nmlp_3283 protein network | https://string-db.org/network/268739.Nmlp_3283 | Uncharacterized protein. |
| polY1 protein network | https://string-db.org/network/268739.Nmlp_3284 | DNA-directed DNA polymerase Y; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismat [...] |
| Nmlp_3285 protein network | https://string-db.org/network/268739.Nmlp_3285 | DUF87 domain protein. |
| tpiA protein network | https://string-db.org/network/268739.Nmlp_3286 | Triosephosphate isomerase; Involved in the gluconeogenesis. Catalyzes stereospecifically the conversion of dihydroxyacetone phosphate (DHAP) to D- glyceraldehyde-3-phosphate (G3P); Belongs to the [...] |
| Nmlp_3287 protein network | https://string-db.org/network/268739.Nmlp_3287 | Uncharacterized protein. |
| Nmlp_3288 protein network | https://string-db.org/network/268739.Nmlp_3288 | PQQ repeat protein. |
| Nmlp_3290 protein network | https://string-db.org/network/268739.Nmlp_3290 | DUF1628 domain protein. |
| ferA5 protein network | https://string-db.org/network/268739.Nmlp_3291 | Ferredoxin (2Fe-2S). |
| Nmlp_3292 protein network | https://string-db.org/network/268739.Nmlp_3292 | UspA domain protein. |
| Nmlp_3293 protein network | https://string-db.org/network/268739.Nmlp_3293 | Small CPxCG-related zinc finger protein. |
| Nmlp_3294 protein network | https://string-db.org/network/268739.Nmlp_3294 | Uncharacterized protein. |
| Nmlp_3295 protein network | https://string-db.org/network/268739.Nmlp_3295 | Uncharacterized protein. |
| guaB1 protein network | https://string-db.org/network/268739.Nmlp_3297 | Inosine-5'-monophosphate dehydrogenase; Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesi [...] |
| Nmlp_3298 protein network | https://string-db.org/network/268739.Nmlp_3298 | Uncharacterized protein. |
| Nmlp_3299 protein network | https://string-db.org/network/268739.Nmlp_3299 | Putative AhpD family alkylhydroperoxidase. |
| Nmlp_3300 protein network | https://string-db.org/network/268739.Nmlp_3300 | Uncharacterized protein. |
| katG protein network | https://string-db.org/network/268739.Nmlp_3301 | Catalase-peroxidase; Bifunctional enzyme with both catalase and broad-spectrum peroxidase activity; Belongs to the peroxidase family. Peroxidase/catalase subfamily. |
| thrB protein network | https://string-db.org/network/268739.Nmlp_3303 | Homoserine kinase; Catalyzes the ATP-dependent phosphorylation of L-homoserine to L-homoserine phosphate; Belongs to the GHMP kinase family. Homoserine kinase subfamily. |
| sucD protein network | https://string-db.org/network/268739.Nmlp_3304 | succinate--CoA ligase (ADP-forming) alpha subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP [...] |
| sucC protein network | https://string-db.org/network/268739.Nmlp_3305 | succinate--CoA ligase (ADP-forming) beta subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP a [...] |
| pccB protein network | https://string-db.org/network/268739.Nmlp_3307 | propionyl-CoA carboxylase carboxyltransferase component. |
| pccX protein network | https://string-db.org/network/268739.Nmlp_3308 | propionyl-CoA carboxylase small subunit. |
| pccA protein network | https://string-db.org/network/268739.Nmlp_3309 | propionyl-CoA carboxylase biotin carboxylase component. |
| purO protein network | https://string-db.org/network/268739.Nmlp_3310 | Inosine-5'-monophosphate cyclohydrolase,archaeal-type; Catalyzes the cyclization of 5-formylamidoimidazole-4- carboxamide ribonucleotide to IMP. |
| Nmlp_3311 protein network | https://string-db.org/network/268739.Nmlp_3311 | Uncharacterized protein. |
| Nmlp_3313 protein network | https://string-db.org/network/268739.Nmlp_3313 | DUF35 family protein. |
| acaB2 protein network | https://string-db.org/network/268739.Nmlp_3314 | acetyl-CoA C-acetyltransferase. |
| cadA protein network | https://string-db.org/network/268739.Nmlp_3315 | P-type transport ATPase (probable substrate zinc/cadmium). |
| Nmlp_3316 protein network | https://string-db.org/network/268739.Nmlp_3316 | FMN-binding domain protein. |
| Nmlp_3317 protein network | https://string-db.org/network/268739.Nmlp_3317 | Probable secreted glycoprotein. |
| Nmlp_3318 protein network | https://string-db.org/network/268739.Nmlp_3318 | Probable secreted glycoprotein. |
| rnhB protein network | https://string-db.org/network/268739.Nmlp_3319 | Ribonuclease H, type 2; Endonuclease that specifically degrades the RNA of RNA-DNA hybrids; Belongs to the RNase HII family. |
| cofH protein network | https://string-db.org/network/268739.Nmlp_3320 | 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 2. |
| Nmlp_3321 protein network | https://string-db.org/network/268739.Nmlp_3321 | DUF790 family protein. |
| nthB protein network | https://string-db.org/network/268739.Nmlp_3322 | Endonuclease 3. |
| Nmlp_3323 protein network | https://string-db.org/network/268739.Nmlp_3323 | DUF371 family protein. |
| Nmlp_3324 protein network | https://string-db.org/network/268739.Nmlp_3324 | Uncharacterized protein. |
| Nmlp_3325 protein network | https://string-db.org/network/268739.Nmlp_3325 | AstE domain protein. |
| Nmlp_3326 protein network | https://string-db.org/network/268739.Nmlp_3326 | UPF0179 family protein; Belongs to the UPF0179 family. |
| acs2 protein network | https://string-db.org/network/268739.Nmlp_3327 | acyl-CoA synthetase. |
| Nmlp_3328 protein network | https://string-db.org/network/268739.Nmlp_3328 | Uncharacterized protein. |
| fadA4 protein network | https://string-db.org/network/268739.Nmlp_3330 | Enoyl-CoA hydratase; Gene has frameshifts and lacks a central region; locus_tag: Nmlp_3329; product: IS1341-type transposase NmIRS28 (nonfunctional); Belongs to the enoyl-CoA hydratase/isomerase [...] |
| Nmlp_3331 protein network | https://string-db.org/network/268739.Nmlp_3331 | LysE family transport protein. |
| Nmlp_3332 protein network | https://string-db.org/network/268739.Nmlp_3332 | HD family hydrolase. |
| Nmlp_3333 protein network | https://string-db.org/network/268739.Nmlp_3333 | DUF457 family protein. |
| Nmlp_3334 protein network | https://string-db.org/network/268739.Nmlp_3334 | GNAT family acetyltransferase. |
| Nmlp_3335 protein network | https://string-db.org/network/268739.Nmlp_3335 | Uncharacterized protein. |
| Nmlp_3336 protein network | https://string-db.org/network/268739.Nmlp_3336 | Dodecin. |
| Nmlp_3337 protein network | https://string-db.org/network/268739.Nmlp_3337 | AI-2E family transport protein. |
| Nmlp_3338 protein network | https://string-db.org/network/268739.Nmlp_3338 | Small CPxCG-related zinc finger protein. |
| Nmlp_3340 protein network | https://string-db.org/network/268739.Nmlp_3340 | Uncharacterized protein; Gene is interrupted (frameshift,in-frame stop) and is truncated at both termini; locus_tag: Nmlp_3339; product: IS1341-type transposase NmIRS27 (nonfunctional). |
| Nmlp_3341 protein network | https://string-db.org/network/268739.Nmlp_3341 | Uncharacterized protein. |
| Nmlp_3342 protein network | https://string-db.org/network/268739.Nmlp_3342 | Uncharacterized protein. |
| Nmlp_3343 protein network | https://string-db.org/network/268739.Nmlp_3343 | Uncharacterized protein. |
| Nmlp_3344 protein network | https://string-db.org/network/268739.Nmlp_3344 | Small CPxCG-related zinc finger protein. |
| Nmlp_3345 protein network | https://string-db.org/network/268739.Nmlp_3345 | Uncharacterized protein. |
| Nmlp_3346 protein network | https://string-db.org/network/268739.Nmlp_3346 | Uncharacterized protein. |
| Nmlp_3347 protein network | https://string-db.org/network/268739.Nmlp_3347 | Uncharacterized protein. |
| Nmlp_3349 protein network | https://string-db.org/network/268739.Nmlp_3349 | Uncharacterized protein. |
| Nmlp_3350 protein network | https://string-db.org/network/268739.Nmlp_3350 | Uncharacterized protein. |
| htr8a protein network | https://string-db.org/network/268739.Nmlp_3351 | Transducer protein Htr8. |
| Nmlp_3352 protein network | https://string-db.org/network/268739.Nmlp_3352 | Probable S-adenosylmethionine-dependent methyltransferase. |
| Nmlp_3353 protein network | https://string-db.org/network/268739.Nmlp_3353 | Flavin reductase domain protein. |
| Nmlp_3354 protein network | https://string-db.org/network/268739.Nmlp_3354 | Peptidase M20 family protein (homolog to carboxypeptidase). |
| Nmlp_3355 protein network | https://string-db.org/network/268739.Nmlp_3355 | Uncharacterized protein. |
| Nmlp_3356 protein network | https://string-db.org/network/268739.Nmlp_3356 | Homolog to cytochrome c-type biogenesis protein CcdA. |
| Nmlp_3357 protein network | https://string-db.org/network/268739.Nmlp_3357 | DUF2249 family protein. |
| Nmlp_3358 protein network | https://string-db.org/network/268739.Nmlp_3358 | Uncharacterized protein. |
| Nmlp_3359 protein network | https://string-db.org/network/268739.Nmlp_3359 | DUF2249 family protein. |
| Nmlp_3360 protein network | https://string-db.org/network/268739.Nmlp_3360 | Cupin 2 barrel domain protein. |
| Nmlp_3361 protein network | https://string-db.org/network/268739.Nmlp_3361 | DsrE domain protein. |
| Nmlp_3362 protein network | https://string-db.org/network/268739.Nmlp_3362 | Receiver/sensor box histidine kinase. |
| Nmlp_3365 protein network | https://string-db.org/network/268739.Nmlp_3365 | Glyoxalase domain protein. |
| sdhA2 protein network | https://string-db.org/network/268739.Nmlp_3366 | Succinate dehydrogenase subunit A; Deleted EC_number 1.3.99.1. |
| dadA protein network | https://string-db.org/network/268739.Nmlp_3367 | Homolog to D-aspartate oxidase. |
| Nmlp_3368 protein network | https://string-db.org/network/268739.Nmlp_3368 | Uncharacterized protein. |
| cpx protein network | https://string-db.org/network/268739.Nmlp_3369 | CytC-type peroxidase. |
| Nmlp_3370 protein network | https://string-db.org/network/268739.Nmlp_3370 | Thioredoxin domain protein. |
| ccmF1 protein network | https://string-db.org/network/268739.Nmlp_3371 | Cytochrome c-type biogenesis protein CcmF. |
| ccmB protein network | https://string-db.org/network/268739.Nmlp_3372 | ABC-type transport system permease protein (probable substrate heme). |
| ccmA protein network | https://string-db.org/network/268739.Nmlp_3373 | ABC-type transport system ATP-binding protein (probable substrate heme). |
| ccmE protein network | https://string-db.org/network/268739.Nmlp_3374 | Cytochrome c-type biogenesis protein CcmE. |
| Nmlp_3375 protein network | https://string-db.org/network/268739.Nmlp_3375 | Molybdopterin-binding domain protein. |
| Nmlp_3376 protein network | https://string-db.org/network/268739.Nmlp_3376 | Uncharacterized protein. |
| ccmC protein network | https://string-db.org/network/268739.Nmlp_3377 | ABC-type transport system permease protein (probable substrate heme). |
| Nmlp_3378 protein network | https://string-db.org/network/268739.Nmlp_3378 | Uncharacterized protein. |
| Nmlp_3379 protein network | https://string-db.org/network/268739.Nmlp_3379 | Uncharacterized protein. |
| Nmlp_3380 protein network | https://string-db.org/network/268739.Nmlp_3380 | UspA domain protein. |
| Nmlp_3381 protein network | https://string-db.org/network/268739.Nmlp_3381 | Fumarylacetoacetase family protein. |
| Nmlp_3382 protein network | https://string-db.org/network/268739.Nmlp_3382 | MmgE/PrpD family protein. |
| Nmlp_3383 protein network | https://string-db.org/network/268739.Nmlp_3383 | UPF0361 family protein. |
| Nmlp_3384 protein network | https://string-db.org/network/268739.Nmlp_3384 | Uncharacterized protein. |
| Nmlp_3385 protein network | https://string-db.org/network/268739.Nmlp_3385 | Receiver/sensor box histidine kinase. |
| Nmlp_3387 protein network | https://string-db.org/network/268739.Nmlp_3387 | AstE domain protein. |
| htpX protein network | https://string-db.org/network/268739.Nmlp_3388 | HtpX-like protease; Belongs to the peptidase M48B family. |
| Nmlp_3389 protein network | https://string-db.org/network/268739.Nmlp_3389 | Uncharacterized protein. |
| cbf5 protein network | https://string-db.org/network/268739.Nmlp_3391 | tRNA-Pro; Could be responsible for synthesis of pseudouridine from uracil-55 in the psi GC loop of transfer RNAs; Belongs to the pseudouridine synthase TruB family. Type 2 subfamily. |
| cmk2 protein network | https://string-db.org/network/268739.Nmlp_3392 | Cytidylate kinase. |
| Nmlp_3393 protein network | https://string-db.org/network/268739.Nmlp_3393 | DUF106 family protein. |
| Nmlp_3394 protein network | https://string-db.org/network/268739.Nmlp_3394 | DUF3006 family protein. |
| Nmlp_3395 protein network | https://string-db.org/network/268739.Nmlp_3395 | Beta-lactamase domain protein. |
| Nmlp_3396 protein network | https://string-db.org/network/268739.Nmlp_3396 | Sensor box histidine kinase. |
| adk1 protein network | https://string-db.org/network/268739.Nmlp_3397 | Adenylate kinase; Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolis [...] |
| Nmlp_3398 protein network | https://string-db.org/network/268739.Nmlp_3398 | Uncharacterized protein. |
| Nmlp_3400 protein network | https://string-db.org/network/268739.Nmlp_3400 | DMT superfamily transport protein. |
| Nmlp_3401 protein network | https://string-db.org/network/268739.Nmlp_3401 | HTH domain protein. |
| Nmlp_3402 protein network | https://string-db.org/network/268739.Nmlp_3402 | Uncharacterized protein. |
| Nmlp_3403 protein network | https://string-db.org/network/268739.Nmlp_3403 | HTH domain protein. |
| Nmlp_3404 protein network | https://string-db.org/network/268739.Nmlp_3404 | Peptidase S26 domain protein. |
| Nmlp_3411 protein network | https://string-db.org/network/268739.Nmlp_3411 | Uncharacterized protein. |
| Nmlp_3412 protein network | https://string-db.org/network/268739.Nmlp_3412 | Uncharacterized protein. |
| Nmlp_3413 protein network | https://string-db.org/network/268739.Nmlp_3413 | Probable secreted glycoprotein. |
| Nmlp_3414 protein network | https://string-db.org/network/268739.Nmlp_3414 | Sensor box histidine kinase. |
| nuoA protein network | https://string-db.org/network/268739.Nmlp_3415 | NADH dehydrogenase-like complex subunit A. |
| nuoB protein network | https://string-db.org/network/268739.Nmlp_3416 | NADH dehydrogenase-like complex subunit B; Belongs to the complex I 20 kDa subunit family. |
| nuoCD protein network | https://string-db.org/network/268739.Nmlp_3417 | NADH dehydrogenase-like complex subunit CD. |
| nuoH protein network | https://string-db.org/network/268739.Nmlp_3418 | NADH dehydrogenase-like complex subunit H. |
| nuoI1 protein network | https://string-db.org/network/268739.Nmlp_3419 | NADH dehydrogenase-like complex subunit I. |
| nuoJ1 protein network | https://string-db.org/network/268739.Nmlp_3421 | Gene: nuoI2; product: NADH dehydrogenase-like complex subunit I (nonfunctional). |
| nuoJ2 protein network | https://string-db.org/network/268739.Nmlp_3422 | NADH dehydrogenase-like complex subunit J2. |
| nuoK protein network | https://string-db.org/network/268739.Nmlp_3423 | NADH dehydrogenase-like complex subunit K. |
| nuoL protein network | https://string-db.org/network/268739.Nmlp_3424 | NADH dehydrogenase-like complex subunit L. |
| nuoM protein network | https://string-db.org/network/268739.Nmlp_3425 | NADH dehydrogenase-like complex subunit M. |
| nuoN protein network | https://string-db.org/network/268739.Nmlp_3426 | NADH dehydrogenase-like complex subunit N. |
| Nmlp_3427 protein network | https://string-db.org/network/268739.Nmlp_3427 | DHH/RecJ family phosphoesterase. |
| cbs10 protein network | https://string-db.org/network/268739.Nmlp_3428 | CBS/parB domain protein. |
| Nmlp_3429 protein network | https://string-db.org/network/268739.Nmlp_3429 | Uncharacterized protein. |
| Nmlp_3430 protein network | https://string-db.org/network/268739.Nmlp_3430 | Uncharacterized protein. |
| Nmlp_3431 protein network | https://string-db.org/network/268739.Nmlp_3431 | Probable oxidoreductase (short-chain dehydrogenase family). |
| coxA protein network | https://string-db.org/network/268739.Nmlp_3433 | Cox-type terminal oxidase subunit I; Belongs to the heme-copper respiratory oxidase family. |
| Nmlp_3434 protein network | https://string-db.org/network/268739.Nmlp_3434 | Uncharacterized protein. |
| Nmlp_3435 protein network | https://string-db.org/network/268739.Nmlp_3435 | Uncharacterized protein. |
| coxC protein network | https://string-db.org/network/268739.Nmlp_3436 | Cox-type terminal oxidase subunit III. |
| coxB protein network | https://string-db.org/network/268739.Nmlp_3437 | Cox-type terminal oxidase subunit II. |
| ctaB protein network | https://string-db.org/network/268739.Nmlp_3438 | Protoheme IX geranylgeranyltransferase; Converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group. |
| Nmlp_3439 protein network | https://string-db.org/network/268739.Nmlp_3439 | GHMP family kinase (homolog to beta-ribofuranosylaminobenzene 5'-phosphate synthase); Catalyzes the condensation of 4-aminobenzoate (pABA) with 5- phospho-alpha-D-ribose 1-diphosphate (PRPP) to p [...] |
| Nmlp_3440 protein network | https://string-db.org/network/268739.Nmlp_3440 | Uncharacterized protein. |
| Nmlp_3441 protein network | https://string-db.org/network/268739.Nmlp_3441 | CopG domain protein. |
| Nmlp_3442 protein network | https://string-db.org/network/268739.Nmlp_3442 | Uncharacterized protein. |
| tfs2 protein network | https://string-db.org/network/268739.Nmlp_3443 | Transcription elongation factor TFS; Belongs to the archaeal rpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family. |
| mntH protein network | https://string-db.org/network/268739.Nmlp_3444 | NRAMP family transport protein (probable substrate divalent metal cation). |
| Nmlp_3445 protein network | https://string-db.org/network/268739.Nmlp_3445 | phytanoyl-CoA dioxygenase domain protein. |
| apbC2 protein network | https://string-db.org/network/268739.Nmlp_3446 | Fe-S cluster carrier protein ApbC; Binds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP; Belongs to the Mrp/NBP35 ATP-binding proteins family. |
| Nmlp_3447 protein network | https://string-db.org/network/268739.Nmlp_3447 | Uncharacterized protein. |
| Nmlp_3448 protein network | https://string-db.org/network/268739.Nmlp_3448 | Probable anaerobic dehydrogenase membrane anchor subunit. |
| Nmlp_3449 protein network | https://string-db.org/network/268739.Nmlp_3449 | Probable anaerobic dehydrogenase iron-sulfur-binding subunit. |
| dhs protein network | https://string-db.org/network/268739.Nmlp_3450 | Deoxyhypusine synthase. |
| Nmlp_3453 protein network | https://string-db.org/network/268739.Nmlp_3453 | HD family hydrolase; Gene has an in-frame stop codon and is truncated at the C-terminus; product: uncharacterized protein (nonfunctional); locus_tag: Nmlp_3452A. |
| cofD protein network | https://string-db.org/network/268739.Nmlp_3454 | 2-phospho-L-lactate transferase; Catalyzes the transfer of the phosphoenolpyruvate moiety from enoylpyruvoyl-2-diphospho-5'-guanosine (EPPG) to 7,8-didemethyl-8- hydroxy-5-deazariboflavin (FO) wi [...] |
| dpd protein network | https://string-db.org/network/268739.Nmlp_3455 | Putative dihydropyrimidine dehydrogenase. |
| citG protein network | https://string-db.org/network/268739.Nmlp_3456 | triphosphoribosyl-dephospho-CoA synthase. |
| Nmlp_3457 protein network | https://string-db.org/network/268739.Nmlp_3457 | DUF447 family protein. |
| znuA1 protein network | https://string-db.org/network/268739.Nmlp_3458 | ABC-type transport system periplasmic substrate-binding protein (probable substrate zinc). |
| znuC1 protein network | https://string-db.org/network/268739.Nmlp_3459 | ABC-type transport system ATP-binding protein (probable substrate zinc). |
| znuB1 protein network | https://string-db.org/network/268739.Nmlp_3460 | ABC-type transport system permease protein (probable substrate zinc). |
| ureF protein network | https://string-db.org/network/268739.Nmlp_3461 | Urease accessory protein UreF. |
| ureE protein network | https://string-db.org/network/268739.Nmlp_3462 | Urease accessory protein UreE; Involved in urease metallocenter assembly. Binds nickel. Probably functions as a nickel donor during metallocenter assembly. Belongs to the UreE family. |
| ureD protein network | https://string-db.org/network/268739.Nmlp_3463 | Urease accessory protein UreD; Required for maturation of urease via the functional incorporation of the urease nickel metallocenter. |
| ureG protein network | https://string-db.org/network/268739.Nmlp_3464 | Urease accessory protein UreG; Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG. |
| ureA protein network | https://string-db.org/network/268739.Nmlp_3465 | Urease gamma subunit; Belongs to the urease gamma subunit family. |
| ureC protein network | https://string-db.org/network/268739.Nmlp_3466 | Urease alpha subunit. |
| ureB protein network | https://string-db.org/network/268739.Nmlp_3467 | Urease beta subunit; Belongs to the urease beta subunit family. |
| Nmlp_3468 protein network | https://string-db.org/network/268739.Nmlp_3468 | Uncharacterized protein. |
| urtA protein network | https://string-db.org/network/268739.Nmlp_3469 | ABC-type transport system periplasmic substrate-binding protein (probable substrate urea/short-chain amides). |
| urtB protein network | https://string-db.org/network/268739.Nmlp_3470 | ABC-type transport system permease protein (probable substrate urea/short-chain amides). |
| urtC protein network | https://string-db.org/network/268739.Nmlp_3471 | ABC-type transport system permease protein (probable substrate urea/short-chain amides). |
| urtD protein network | https://string-db.org/network/268739.Nmlp_3472 | ABC-type transport system ATP-binding protein (probable substrate urea/short-chain amides). |
| urtE protein network | https://string-db.org/network/268739.Nmlp_3473 | ABC-type transport system ATP-binding protein (probable substrate urea/short-chain amides). |
| rps17e protein network | https://string-db.org/network/268739.Nmlp_3474 | 30S ribosomal protein S17e; Belongs to the eukaryotic ribosomal protein eS17 family. |
| asd protein network | https://string-db.org/network/268739.Nmlp_3475 | Aspartate-semialdehyde dehydrogenase. |
| Nmlp_3476 protein network | https://string-db.org/network/268739.Nmlp_3476 | Uncharacterized protein. |
| Nmlp_3477 protein network | https://string-db.org/network/268739.Nmlp_3477 | Cyclase family protein. |
| phoU2 protein network | https://string-db.org/network/268739.Nmlp_3478 | PhoU domain protein; Plays a role in the regulation of phosphate uptake. |
| pstB1 protein network | https://string-db.org/network/268739.Nmlp_3479 | ABC-type transport system ATP-binding protein (probable substrate phosphate); Part of the ABC transporter complex PstSACB involved in phosphate import. Responsible for energy coupling to the tran [...] |
| phoU1 protein network | https://string-db.org/network/268739.Nmlp_3480 | PhoU domain protein. |
| Nmlp_3481 protein network | https://string-db.org/network/268739.Nmlp_3481 | Uncharacterized protein. |
| guaAb protein network | https://string-db.org/network/268739.Nmlp_3482 | GMP synthase (glutamine-hydrolyzing) subunit B; Catalyzes the synthesis of GMP from XMP. |
| pyrG protein network | https://string-db.org/network/268739.Nmlp_3483 | CTP synthase; Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen. Regulates intracellular CTP levels through interactions with the fo [...] |
| trkA1 protein network | https://string-db.org/network/268739.Nmlp_3484 | TrkA domain protein. |
| Nmlp_3486 protein network | https://string-db.org/network/268739.Nmlp_3486 | FNT family transport protein; Gene is interrupted (frameshift,in-frame stop) and lacks a large central region; locus_tag: Nmlp_3485; product: Trk-type transport system (probable substrate potassi [...] |
| tfbA7 protein network | https://string-db.org/network/268739.Nmlp_3487 | Transcription initiation factor TFB. |
| Nmlp_3488 protein network | https://string-db.org/network/268739.Nmlp_3488 | FAD-dependent oxidoreductase. |
| korA protein network | https://string-db.org/network/268739.Nmlp_3489 | Oxoglutarate--ferredoxin oxidoreductase alpha subunit. |
| korB1 protein network | https://string-db.org/network/268739.Nmlp_3490 | Oxoglutarate--ferredoxin oxidoreductase beta subunit. |
| entB2 protein network | https://string-db.org/network/268739.Nmlp_3491 | Isochorismatase family protein. |
| aspS protein network | https://string-db.org/network/268739.Nmlp_3492 | aspartate--tRNA(Asp/Asn) ligase; Aspartyl-tRNA synthetase with relaxed tRNA specificity since it is able to aspartylate not only its cognate tRNA(Asp) but also tRNA(Asn). Reaction proceeds in two [...] |
| Nmlp_3493 protein network | https://string-db.org/network/268739.Nmlp_3493 | Uncharacterized protein. |
| hemC protein network | https://string-db.org/network/268739.Nmlp_3494 | Hydroxymethylbilane synthase (porphobilinogen deaminase). |
| sirA protein network | https://string-db.org/network/268739.Nmlp_3495 | uroporphyrin-III C-methyltransferase; Belongs to the precorrin methyltransferase family. |
| hemD protein network | https://string-db.org/network/268739.Nmlp_3496 | uroporphyrinogen-III synthase. |
| rfcC protein network | https://string-db.org/network/268739.Nmlp_3497 | Replication factor C small subunit. |
| trmG10 protein network | https://string-db.org/network/268739.Nmlp_3498 | tRNA (guanine(10),N(2))-dimethyltransferase. |
| CDN30066.1 protein network | https://string-db.org/network/268739.Nmlp_3501A | Uncharacterized protein. |
| Nmlp_3502 protein network | https://string-db.org/network/268739.Nmlp_3502 | DUF2237 family protein. |
| Nmlp_3503 protein network | https://string-db.org/network/268739.Nmlp_3503 | UPF0033 family protein. |
| Nmlp_3504 protein network | https://string-db.org/network/268739.Nmlp_3504 | FAD-dependent oxidoreductase. |
| Nmlp_3505 protein network | https://string-db.org/network/268739.Nmlp_3505 | DUF1641 domain protein. |
| Nmlp_3506 protein network | https://string-db.org/network/268739.Nmlp_3506 | Receiver/sensor box histidine kinase. |
| Nmlp_3507 protein network | https://string-db.org/network/268739.Nmlp_3507 | GNAT family acetyltransferase. |
| phr1 protein network | https://string-db.org/network/268739.Nmlp_3508 | Deoxyribodipyrimidine photolyase; Belongs to the DNA photolyase family. |
| Nmlp_3509 protein network | https://string-db.org/network/268739.Nmlp_3509 | Uncharacterized protein. |
| dim2 protein network | https://string-db.org/network/268739.Nmlp_3510 | Probable ribosome biogenesis protein Dim2. |
| ths1 protein network | https://string-db.org/network/268739.Nmlp_3511 | Thermosome subunit 1; Belongs to the TCP-1 chaperonin family. |
| aspC2 protein network | https://string-db.org/network/268739.Nmlp_3512 | Pyridoxal phosphate-dependent aminotransferase. |
| ssuA protein network | https://string-db.org/network/268739.Nmlp_3513 | ABC-type transport system periplasmic substrate-binding protein (probable substrate nitrate/sulfonate/bicarbonate). |
| ssuC protein network | https://string-db.org/network/268739.Nmlp_3514 | ABC-type transport system permease protein (probable substrate nitrate/sulfonate/bicarbonate). |
| ssuB protein network | https://string-db.org/network/268739.Nmlp_3515 | ABC-type transport system ATP-binding protein (probable substrate nitrate/sulfonate/bicarbonate). |
| Nmlp_3516 protein network | https://string-db.org/network/268739.Nmlp_3516 | Uncharacterized protein. |
| Nmlp_3517 protein network | https://string-db.org/network/268739.Nmlp_3517 | Probable secreted glycoprotein. |
| Nmlp_3518 protein network | https://string-db.org/network/268739.Nmlp_3518 | Probable secreted glycoprotein. |
| Nmlp_3519 protein network | https://string-db.org/network/268739.Nmlp_3519 | HTH domain protein. |
| Nmlp_3520 protein network | https://string-db.org/network/268739.Nmlp_3520 | Uncharacterized protein. |
| Nmlp_3521 protein network | https://string-db.org/network/268739.Nmlp_3521 | DUF192 family protein. |
| Nmlp_3522 protein network | https://string-db.org/network/268739.Nmlp_3522 | Sensor box histidine kinase. |
| Nmlp_3523 protein network | https://string-db.org/network/268739.Nmlp_3523 | S8 family serine protease. |
| Nmlp_3524 protein network | https://string-db.org/network/268739.Nmlp_3524 | Uncharacterized protein. |
| Nmlp_3525 protein network | https://string-db.org/network/268739.Nmlp_3525 | HTH domain protein. |
| aglI protein network | https://string-db.org/network/268739.Nmlp_3526 | Glycosyltransferase AglI; Product: IS1341-type transposase NmIRS70 (nonfunctional). |
| Nmlp_3527 protein network | https://string-db.org/network/268739.Nmlp_3527 | Uncharacterized protein. |
| Nmlp_3528 protein network | https://string-db.org/network/268739.Nmlp_3528 | UPF0175 family protein. |
| Nmlp_3529 protein network | https://string-db.org/network/268739.Nmlp_3529 | AlkP-core domain protein. |
| Nmlp_3530 protein network | https://string-db.org/network/268739.Nmlp_3530 | Uncharacterized protein. |
| Nmlp_3531 protein network | https://string-db.org/network/268739.Nmlp_3531 | AlkP-core domain protein. |
| Nmlp_3532 protein network | https://string-db.org/network/268739.Nmlp_3532 | AlkP-core domain protein. |
| aglR protein network | https://string-db.org/network/268739.Nmlp_3533 | Probable flippase AglR. |
| Nmlp_3534 protein network | https://string-db.org/network/268739.Nmlp_3534 | Uncharacterized protein. |
| aglG protein network | https://string-db.org/network/268739.Nmlp_3535 | Glycosyltransferase AglG. |
| vapB2 protein network | https://string-db.org/network/268739.Nmlp_3536 | Probable VapB/AbrB family antitoxin. |
| vapC2 protein network | https://string-db.org/network/268739.Nmlp_3537 | Probable ribonuclease VapC. |
| Nmlp_3539 protein network | https://string-db.org/network/268739.Nmlp_3539 | Product: probable secreted glycoprotein (nonfunctional). |
| Nmlp_3540 protein network | https://string-db.org/network/268739.Nmlp_3540 | Uncharacterized protein. |
| Nmlp_3541 protein network | https://string-db.org/network/268739.Nmlp_3541 | Uncharacterized protein. |
| Nmlp_3542 protein network | https://string-db.org/network/268739.Nmlp_3542 | Probable secreted glycoprotein. |
| Nmlp_3543 protein network | https://string-db.org/network/268739.Nmlp_3543 | Homolog to arabinopyranose mutase. |
| SfuA protein network | https://string-db.org/network/268739.Nmlp_3544 | ABC-type transport system periplasmic substrate-binding protein. |
| Nmlp_3545 protein network | https://string-db.org/network/268739.Nmlp_3545 | Uncharacterized protein. |
| Nmlp_3546 protein network | https://string-db.org/network/268739.Nmlp_3546 | Uncharacterized protein. |
| gtl8 protein network | https://string-db.org/network/268739.Nmlp_3547 | Dolichyl-phosphate hexosyltransferase. |
| Nmlp_3548 protein network | https://string-db.org/network/268739.Nmlp_3548 | GMC family oxidoreductase. |
| Nmlp_3549 protein network | https://string-db.org/network/268739.Nmlp_3549 | LacC domain protein. |
| SfuB protein network | https://string-db.org/network/268739.Nmlp_3550 | ABC-type transport system permease protein. |
| aglF protein network | https://string-db.org/network/268739.Nmlp_3551 | UTP--glucose-1-phosphate uridylyltransferase AglF. |
| Nmlp_3552 protein network | https://string-db.org/network/268739.Nmlp_3552 | Uncharacterized protein. |
| alaS protein network | https://string-db.org/network/268739.Nmlp_3553 | alanine--tRNA ligase; Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA( [...] |
| Nmlp_3554 protein network | https://string-db.org/network/268739.Nmlp_3554 | Small CPxCG-related zinc finger protein. |
| Nmlp_3555 protein network | https://string-db.org/network/268739.Nmlp_3555 | Uncharacterized protein. |
| Nmlp_3556 protein network | https://string-db.org/network/268739.Nmlp_3556 | Uncharacterized protein. |
| ala protein network | https://string-db.org/network/268739.Nmlp_3557 | Alanine dehydrogenase; Catalyzes the NAD(+)-dependent oxidative deamination of L- alanine to pyruvate, and the reverse reaction, the reductive amination of pyruvate; Belongs to the ornithine cycl [...] |
| htr41 protein network | https://string-db.org/network/268739.Nmlp_3558 | Transducer protein Htr41. |
| Nmlp_3559 protein network | https://string-db.org/network/268739.Nmlp_3559 | Uncharacterized protein. |
| Nmlp_3561 protein network | https://string-db.org/network/268739.Nmlp_3561 | Homolog to DNA topoisomerase 1. |
| endA protein network | https://string-db.org/network/268739.Nmlp_3562 | tRNA-splicing endonuclease; Endonuclease that removes tRNA introns. Cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules be [...] |
| trpS protein network | https://string-db.org/network/268739.Nmlp_3563 | tryptophan--tRNA ligase; Catalyzes the attachment of tryptophan to tRNA(Trp). |
| gcvT protein network | https://string-db.org/network/268739.Nmlp_3564 | Homolog to glycine cleavage system protein T. |
| Nmlp_3565 protein network | https://string-db.org/network/268739.Nmlp_3565 | Uncharacterized protein. |
| Nmlp_3566 protein network | https://string-db.org/network/268739.Nmlp_3566 | Uncharacterized protein. |
| Nmlp_3567 protein network | https://string-db.org/network/268739.Nmlp_3567 | Uncharacterized protein. |
| Nmlp_3568 protein network | https://string-db.org/network/268739.Nmlp_3568 | DUF2157 domain protein. |
| Nmlp_3569 protein network | https://string-db.org/network/268739.Nmlp_3569 | Uncharacterized protein. |
| idsA2 protein network | https://string-db.org/network/268739.Nmlp_3570 | Bifunctional short chain isoprenyl diphosphate synthase; Belongs to the FPP/GGPP synthase family. |
| prsA protein network | https://string-db.org/network/268739.Nmlp_3571 | Ribose-phosphate pyrophosphokinase; Involved in the biosynthesis of the central metabolite phospho-alpha-D-ribosyl-1-pyrophosphate (PRPP) via the transfer of pyrophosphoryl group from ATP to 1-hy [...] |
| Nmlp_3572 protein network | https://string-db.org/network/268739.Nmlp_3572 | Probable secreted glycoprotein. |
| ileS protein network | https://string-db.org/network/268739.Nmlp_3573 | isoleucine--tRNA ligase; Catalyzes the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such err [...] |
| pmm2 protein network | https://string-db.org/network/268739.Nmlp_3574 | Phosphohexomutase (phosphoglucomutase / phosphomannomutase); Belongs to the phosphohexose mutase family. |
| recJ1 protein network | https://string-db.org/network/268739.Nmlp_3575 | single-stranded-DNA-specific exonuclease RecJ1. |
| crtI2 protein network | https://string-db.org/network/268739.Nmlp_3576 | Phytoene dehydrogenase (phytoene desaturase). |
| brp protein network | https://string-db.org/network/268739.Nmlp_3577 | Beta-carotene 15,15'-dioxygenase Brp; Catalyzes the cleavage of beta-carotene at its central double bond (15,15') to yield two molecules of all-trans-retinal. Belongs to the Brp/Blh beta-carotene [...] |
| Nmlp_3578 protein network | https://string-db.org/network/268739.Nmlp_3578 | PgpA domain protein. |
| ncsA protein network | https://string-db.org/network/268739.Nmlp_3579 | Zinc-dependent nuclease. |
| Nmlp_3580 protein network | https://string-db.org/network/268739.Nmlp_3580 | TrmB family transcription regulator. |
| amtB2 protein network | https://string-db.org/network/268739.Nmlp_3581 | Transport protein (probable substrate ammonium). |
| Nmlp_3582 protein network | https://string-db.org/network/268739.Nmlp_3582 | GlnK-type ammonia transport regulator; Belongs to the P(II) protein family. |
| Nmlp_3583 protein network | https://string-db.org/network/268739.Nmlp_3583 | Amine oxidase (copper-containing); Belongs to the copper/topaquinone oxidase family. |
| Nmlp_3584 protein network | https://string-db.org/network/268739.Nmlp_3584 | Uncharacterized protein. |
| rad25a protein network | https://string-db.org/network/268739.Nmlp_3585 | DNA repair helicase Rad25. |
| grpE protein network | https://string-db.org/network/268739.Nmlp_3586 | DnaJ/DnaK ATPase stimulator GrpE; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and Grp [...] |
| dnaK protein network | https://string-db.org/network/268739.Nmlp_3588 | Hsp70-type molecular chaperone DnaK; Acts as a chaperone. |
| CCQ37711.1 protein network | https://string-db.org/network/268739.Nmlp_3589A | Uncharacterized protein. |
| dnaJ protein network | https://string-db.org/network/268739.Nmlp_3591 | Molecular chaperone DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in a [...] |
| Nmlp_3592 protein network | https://string-db.org/network/268739.Nmlp_3592 | Uncharacterized protein. |
| Nmlp_3593 protein network | https://string-db.org/network/268739.Nmlp_3593 | Uncharacterized protein. |
| sppA1 protein network | https://string-db.org/network/268739.Nmlp_3594 | Signal peptide peptidase SppA. |
| Nmlp_3595 protein network | https://string-db.org/network/268739.Nmlp_3595 | UPF0753 family protein; Belongs to the UPF0753 family. |
| mrpD4 protein network | https://string-db.org/network/268739.Nmlp_3596 | Mrp-type sodium/proton antiporter system subunit D4. |
| Nmlp_3598 protein network | https://string-db.org/network/268739.Nmlp_3598 | VanZ family protein; Product: uncharacterized protein (nonfunctional). |
| Nmlp_3599 protein network | https://string-db.org/network/268739.Nmlp_3599 | TIGR01210 family protein. |
| Nmlp_3601 protein network | https://string-db.org/network/268739.Nmlp_3601 | MATE efflux family protein. |
| Nmlp_3602 protein network | https://string-db.org/network/268739.Nmlp_3602 | Uncharacterized protein. |
| Nmlp_3603 protein network | https://string-db.org/network/268739.Nmlp_3603 | Small CPxCG-related zinc finger protein. |
| purQ protein network | https://string-db.org/network/268739.Nmlp_3604 | Phosphoribosylformylglycinamidine synthase subunit PurQ; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent c [...] |
| purS protein network | https://string-db.org/network/268739.Nmlp_3605 | Phosphoribosylformylglycinamidine synthase subunit PurS; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent c [...] |
| Nmlp_3606 protein network | https://string-db.org/network/268739.Nmlp_3606 | Uncharacterized protein. |
| Nmlp_3607 protein network | https://string-db.org/network/268739.Nmlp_3607 | Uncharacterized protein. |
| Nmlp_3608 protein network | https://string-db.org/network/268739.Nmlp_3608 | Probable FAD-dependent oxidoreductase. |
| Nmlp_3610 protein network | https://string-db.org/network/268739.Nmlp_3610 | IS200-type transposase ISNamo19; Gene is interrupted (frameshift,in-frame stop) and is truncated at the N-terminus; locus_tag: Nmlp_3609; product: ISH14-type transposase NmIRS15 (nonfunctional). |
| Nmlp_3611 protein network | https://string-db.org/network/268739.Nmlp_3611 | IS1341-type transposase ISNamo19. |
| Nmlp_3612 protein network | https://string-db.org/network/268739.Nmlp_3612 | Homolog to S-adenosylmethionine-dependent methyltransferase. |
| htr8b protein network | https://string-db.org/network/268739.Nmlp_3615 | Transducer protein Htr8; Product: major facilitator superfamily transporter (probable substrate nitrate/nitrite) (nonfunctional). |
| Nmlp_3616 protein network | https://string-db.org/network/268739.Nmlp_3616 | Receiver/sensor box protein. |
| Nmlp_3619 protein network | https://string-db.org/network/268739.Nmlp_3619 | ABC-type transport system permease protein (Probable substrate glucose); Product: uncharacterized protein (nonfunctional). |
| Nmlp_3620 protein network | https://string-db.org/network/268739.Nmlp_3620 | ABC-type transport system permease protein (probable substrate glucose). |
| Nmlp_3621 protein network | https://string-db.org/network/268739.Nmlp_3621 | ABC-type transport system ATP-binding protein (probable substrate glucose). |
| Nmlp_3622 protein network | https://string-db.org/network/268739.Nmlp_3622 | ABC-type transport system periplasmic substrate-binding protein (probable substrate glucose). |
| pucM protein network | https://string-db.org/network/268739.Nmlp_3623 | 5-hydroxyisourate hydrolase. |
| pucL1 protein network | https://string-db.org/network/268739.Nmlp_3624 | Uricase; Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S)-allantoin. |
| pucL2 protein network | https://string-db.org/network/268739.Nmlp_3625 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase. |
| pucH protein network | https://string-db.org/network/268739.Nmlp_3626 | Probable allantoinase. |
| mobA2 protein network | https://string-db.org/network/268739.Nmlp_3627 | Molybdenum cofactor nucleotidyltransferase domain protein. |
| Nmlp_3628 protein network | https://string-db.org/network/268739.Nmlp_3628 | Metal dependent hydrolase family protein. |
| coxM protein network | https://string-db.org/network/268739.Nmlp_3629 | Molybdopterin-containing oxidoreductase medium subunit. |
| coxL protein network | https://string-db.org/network/268739.Nmlp_3630 | Molybdopterin-containing oxidoreductase large subunit. |
| coxS protein network | https://string-db.org/network/268739.Nmlp_3631 | Molybdopterin-containing oxidoreductase small subunit. |
| xdhC protein network | https://string-db.org/network/268739.Nmlp_3632 | XdhC family protein. |
| uraA2 protein network | https://string-db.org/network/268739.Nmlp_3633 | Xanthine/uracil permease family transport protein. |
| Nmlp_3634 protein network | https://string-db.org/network/268739.Nmlp_3634 | Uncharacterized protein. |
| Nmlp_3636 protein network | https://string-db.org/network/268739.Nmlp_3636 | Amidase (hydantoinase/carbamoylase family). |
| Nmlp_3637 protein network | https://string-db.org/network/268739.Nmlp_3637 | IclR family transcription regulator. |
| Nmlp_3639 protein network | https://string-db.org/network/268739.Nmlp_3639 | ISH14-type transposase ISNamo7. |
| Nmlp_3640 protein network | https://string-db.org/network/268739.Nmlp_3640 | Uncharacterized protein. |
| Nmlp_3641 protein network | https://string-db.org/network/268739.Nmlp_3641 | GalE family epimerase/dehydratase. |
| pyrE2 protein network | https://string-db.org/network/268739.Nmlp_3642 | Homolog to orotate phosphoribosyltransferase; Belongs to the purine/pyrimidine phosphoribosyltransferase family. |
| glpC protein network | https://string-db.org/network/268739.Nmlp_3643 | Glycerol-3-phosphate dehydrogenase subunit C. |
| glpB protein network | https://string-db.org/network/268739.Nmlp_3644 | Glycerol-3-phosphate dehydrogenase subunit B. |
| glpA1 protein network | https://string-db.org/network/268739.Nmlp_3645 | Glycerol-3-phosphate dehydrogenase subunit A; Belongs to the FAD-dependent glycerol-3-phosphate dehydrogenase family. |
| glpK1 protein network | https://string-db.org/network/268739.Nmlp_3646 | Glycerol kinase; Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn- glycerol 3-phosphate. |
| Nmlp_3647 protein network | https://string-db.org/network/268739.Nmlp_3647 | Uncharacterized protein. |
| orc6 protein network | https://string-db.org/network/268739.Nmlp_3648 | Orc1-type DNA replication protein. |
| mtfK3 protein network | https://string-db.org/network/268739.Nmlp_3650 | FKBP-type peptidylprolyl isomerase. |
| Nmlp_3651 protein network | https://string-db.org/network/268739.Nmlp_3651 | Lrp/AsnC family transcription regulator. |
| GuaD3 protein network | https://string-db.org/network/268739.Nmlp_3652 | Amidohydrolase domain protein. |
| Nmlp_3653 protein network | https://string-db.org/network/268739.Nmlp_3653 | ISH14-type transposase ISNamo9. |
| Nmlp_3655 protein network | https://string-db.org/network/268739.Nmlp_3655 | Uncharacterized protein; Gene has a frameshift; locus_tag: Nmlp_3654; product: probable S-adenosylmethionine-dependent methyltransferase (nonfunctional); conceptual translation after in silico re [...] |
| Nmlp_3656 protein network | https://string-db.org/network/268739.Nmlp_3656 | NMT1/THI5 domain protein. |
| Nmlp_3657 protein network | https://string-db.org/network/268739.Nmlp_3657 | ABC-type transport system periplasmic substrate-binding protein. |
| Nmlp_3658 protein network | https://string-db.org/network/268739.Nmlp_3658 | ABC-type transport system periplasmic substrate-binding protein. |
| Nmlp_3659 protein network | https://string-db.org/network/268739.Nmlp_3659 | Cupin 2 barrel domain protein. |
| aor2 protein network | https://string-db.org/network/268739.Nmlp_3660 | Aldehyde ferredoxin oxidoreductase. |
| Nmlp_3661 protein network | https://string-db.org/network/268739.Nmlp_3661 | Glyoxalase domain protein. |
| aor1 protein network | https://string-db.org/network/268739.Nmlp_3663 | Aldehyde ferredoxin oxidoreductase; Product: probable DNA-binding protein (nonfunctional). |
| Nmlp_3664 protein network | https://string-db.org/network/268739.Nmlp_3664 | Uncharacterized protein. |
| Nmlp_3665 protein network | https://string-db.org/network/268739.Nmlp_3665 | ThiJ/PfpI domain protein. |
| Nmlp_3666 protein network | https://string-db.org/network/268739.Nmlp_3666 | Uncharacterized protein. |
| fadA3 protein network | https://string-db.org/network/268739.Nmlp_3667 | enoyl-CoA hydratase. |
| samp1 protein network | https://string-db.org/network/268739.Nmlp_3668 | Ubiquitin-like modifier protein SAMP1. |
| tgtA protein network | https://string-db.org/network/268739.Nmlp_3669 | tRNA-guanine(15) transglycosylase; Exchanges the guanine residue with 7-cyano-7-deazaguanine (preQ0) at position 15 in the dihydrouridine loop (D-loop) of archaeal tRNAs; Belongs to the archaeosi [...] |
| Nmlp_3670 protein network | https://string-db.org/network/268739.Nmlp_3670 | NikR family transcription regulator; Transcriptional regulator; Belongs to the transcriptional regulatory CopG/NikR family. |
| cobA protein network | https://string-db.org/network/268739.Nmlp_3671 | cob(I)alamin adenosyltransferase. |
| Nmlp_3672 protein network | https://string-db.org/network/268739.Nmlp_3672 | Uncharacterized protein. |
| Nmlp_3673 protein network | https://string-db.org/network/268739.Nmlp_3673 | UspA domain protein. |
| Nmlp_3674 protein network | https://string-db.org/network/268739.Nmlp_3674 | SSSF family transport protein; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| Nmlp_3675 protein network | https://string-db.org/network/268739.Nmlp_3675 | DUF4212 family protein. |
| Nmlp_3676 protein network | https://string-db.org/network/268739.Nmlp_3676 | ISH9-type transposase ISNamo1. |
| acs5 protein network | https://string-db.org/network/268739.Nmlp_3677 | acyl-CoA synthetase. |
| fadA1 protein network | https://string-db.org/network/268739.Nmlp_3678 | enoyl-CoA hydratase. |
| trxA7 protein network | https://string-db.org/network/268739.Nmlp_3679 | Thioredoxin. |
| livF2 protein network | https://string-db.org/network/268739.Nmlp_3680 | ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acids). |
| livG2 protein network | https://string-db.org/network/268739.Nmlp_3681 | ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acids). |
| livM2 protein network | https://string-db.org/network/268739.Nmlp_3682 | ABC-type transport system permease protein (probable substrate branched-chain amino acids). |
| livH2 protein network | https://string-db.org/network/268739.Nmlp_3683 | ABC-type transport system permease protein (probable substrate branched-chain amino acids). |
| livJ2 protein network | https://string-db.org/network/268739.Nmlp_3684 | ABC-type transport system periplasmic substrate-binding protein (probable substrate branched-chain amino acids). |
| acs4 protein network | https://string-db.org/network/268739.Nmlp_3685 | acyl-CoA synthetase. |
| Nmlp_3686 protein network | https://string-db.org/network/268739.Nmlp_3686 | Integrase family protein / sensor/bat box HTH-10 family transcription regulator. |
| acs3 protein network | https://string-db.org/network/268739.Nmlp_3687 | acyl-CoA synthetase. |
| cbiP protein network | https://string-db.org/network/268739.Nmlp_3688 | Adenosylcobyrate synthase; Catalyzes amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide. NH(2) groups are provided by glutamine, and one molecule of ATP is hydrogenolyzed for [...] |
| Nmlp_3689 protein network | https://string-db.org/network/268739.Nmlp_3689 | Probable S-adenosylmethionine-dependent methyltransferase. |
| Nmlp_3690 protein network | https://string-db.org/network/268739.Nmlp_3690 | Small CPxCG-related zinc finger protein. |
| apn1 protein network | https://string-db.org/network/268739.Nmlp_3691 | Endonuclease 4; Endonuclease IV plays a role in DNA repair. It cleaves phosphodiester bonds at apurinic or apyrimidinic sites (AP sites) to produce new 5'-ends that are base-free deoxyribose 5-ph [...] |
| lpl1 protein network | https://string-db.org/network/268739.Nmlp_3692 | Lipoate-protein ligase domain protein. |
| trkH1 protein network | https://string-db.org/network/268739.Nmlp_3693 | Trk-type transport system (probable substrate potassium). |
| Nmlp_3694 protein network | https://string-db.org/network/268739.Nmlp_3694 | Ribonuclease H domain protein. |
| Nmlp_3695 protein network | https://string-db.org/network/268739.Nmlp_3695 | PfpI family protease. |
| Nmlp_3697 protein network | https://string-db.org/network/268739.Nmlp_3697 | Small CPxCG-related zinc finger protein. |
| korB3 protein network | https://string-db.org/network/268739.Nmlp_3698 | Oxoglutarate--ferredoxin oxidoreductase beta subunit. |
| Nmlp_3699 protein network | https://string-db.org/network/268739.Nmlp_3699 | Uncharacterized protein. |
| ferB2 protein network | https://string-db.org/network/268739.Nmlp_3700 | Ferredoxin (3Fe-4S)(4Fe-4S), zinc-containing; Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
| sufB4 protein network | https://string-db.org/network/268739.Nmlp_3701 | SufB domain protein. |
| tfbA8 protein network | https://string-db.org/network/268739.Nmlp_3702 | Transcription initiation factor TFB; Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB). |
| Nmlp_3703 protein network | https://string-db.org/network/268739.Nmlp_3703 | Small CPxCG-related zinc finger protein. |
| cbs11 protein network | https://string-db.org/network/268739.Nmlp_3704 | DUF21/CBS domain protein. |
| Nmlp_3707 protein network | https://string-db.org/network/268739.Nmlp_3707 | Sensor/bat box HTH-10 family transcription regulator. |
| Nmlp_3709 protein network | https://string-db.org/network/268739.Nmlp_3709 | Probable secreted glycoprotein. |
| Nmlp_3711 protein network | https://string-db.org/network/268739.Nmlp_3711 | Uncharacterized protein; Gene has a frameshift and lacks a large central region; locus_tag: Nmlp_3710; product: ISH7-type transposase NmIRS24 (nonfunctional). |
| Nmlp_3712 protein network | https://string-db.org/network/268739.Nmlp_3712 | MiaB-like tRNA modifying enzyme. |
| nac protein network | https://string-db.org/network/268739.Nmlp_3714 | Nascent polypeptide-associated complex protein; Contacts the emerging nascent chain on the ribosome. Belongs to the NAC-alpha family. |
| trmI protein network | https://string-db.org/network/268739.Nmlp_3715 | tRNA (adenine-N(1))-methyltransferase TrmI. |
| Nmlp_3716 protein network | https://string-db.org/network/268739.Nmlp_3716 | Uncharacterized protein. |
| Nmlp_3717 protein network | https://string-db.org/network/268739.Nmlp_3717 | DUF3179 family protein. |
| tfs1 protein network | https://string-db.org/network/268739.Nmlp_3718 | Transcription elongation factor TFS; Belongs to the archaeal rpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family. |
| bac protein network | https://string-db.org/network/268739.Nmlp_3719 | Bacterioopsin-associated chaperone. |
| bap protein network | https://string-db.org/network/268739.Nmlp_3720 | Bacterioopsin-associated protein. |
| bop protein network | https://string-db.org/network/268739.Nmlp_3721 | Bacteriorhodopsin. |
| Nmlp_3723 protein network | https://string-db.org/network/268739.Nmlp_3723 | Transport protein (probable substrate arsenite). |
| Nmlp_3724 protein network | https://string-db.org/network/268739.Nmlp_3724 | DUF393 family protein. |
| engB protein network | https://string-db.org/network/268739.Nmlp_3725 | Probable GTP-binding protein EngB; Necessary for normal cell division and for the maintenance of normal septation. |
| Nmlp_3726 protein network | https://string-db.org/network/268739.Nmlp_3726 | DUF389 family protein. |
| Nmlp_3727 protein network | https://string-db.org/network/268739.Nmlp_3727 | SIMPL domain protein. |
| maoC4 protein network | https://string-db.org/network/268739.Nmlp_3728 | MaoC domain protein. |
| Nmlp_3729 protein network | https://string-db.org/network/268739.Nmlp_3729 | Probable GTP-binding protein. |
| hjc protein network | https://string-db.org/network/268739.Nmlp_3730 | Holliday junction resolvase Hjc; A structure-specific endonuclease that resolves Holliday junction (HJ) intermediates during genetic recombination. Cleaves 4-way DNA junctions introducing paired [...] |
| Nmlp_3731 protein network | https://string-db.org/network/268739.Nmlp_3731 | Deaminase domain protein. |
| Nmlp_3732 protein network | https://string-db.org/network/268739.Nmlp_3732 | ABCE1 family ribosome recycling factor. |
| Nmlp_3733 protein network | https://string-db.org/network/268739.Nmlp_3733 | Uncharacterized protein. |
| Nmlp_3734 protein network | https://string-db.org/network/268739.Nmlp_3734 | NP_1176A family transcription regulator. |
| pstS2 protein network | https://string-db.org/network/268739.Nmlp_3735 | ABC-type transport system periplasmic substrate-binding protein (probable substrate phosphate). |
| pstC1 protein network | https://string-db.org/network/268739.Nmlp_3736 | ABC-type transport system permease protein (probable substrate phosphate); Part of the binding-protein-dependent transport system for phosphate; probably responsible for the translocation of the [...] |
| pstA3 protein network | https://string-db.org/network/268739.Nmlp_3737 | ABC-type transport system permease protein (probable substrate phosphate). |
| pstB3 protein network | https://string-db.org/network/268739.Nmlp_3738 | ABC-type transport system ATP-binding protein (probable substrate phosphate); Part of the ABC transporter complex PstSACB involved in phosphate import. Responsible for energy coupling to the tran [...] |
| Nmlp_3739 protein network | https://string-db.org/network/268739.Nmlp_3739 | Uncharacterized protein. |
| tupA protein network | https://string-db.org/network/268739.Nmlp_3740 | ABC-type transport system periplasmic substrate-binding protein (probable substrate tungstate). |
| tupB protein network | https://string-db.org/network/268739.Nmlp_3741 | ABC-type transport system permease protein (probable substrate tungstate). |
| tupC protein network | https://string-db.org/network/268739.Nmlp_3742 | ABC-type transport system ATP-binding protein (probable substrate tungstate). |
| Nmlp_3743 protein network | https://string-db.org/network/268739.Nmlp_3743 | ModE family transcription regulator. |
| Nmlp_3744 protein network | https://string-db.org/network/268739.Nmlp_3744 | Sensor box histidine kinase. |
| ppk protein network | https://string-db.org/network/268739.Nmlp_3745 | Polyphosphate kinase; Catalyzes the reversible transfer of the terminal phosphate of ATP to form a long-chain polyphosphate (polyP); Belongs to the polyphosphate kinase 1 (PPK1) family. |
| Nmlp_3746 protein network | https://string-db.org/network/268739.Nmlp_3746 | Metallophosphoesterase domain protein. |
| Nmlp_3747 protein network | https://string-db.org/network/268739.Nmlp_3747 | Uncharacterized protein. |
| Nmlp_3748 protein network | https://string-db.org/network/268739.Nmlp_3748 | HTH-10 family transcription regulator. |
| Nmlp_3749 protein network | https://string-db.org/network/268739.Nmlp_3749 | HTH domain protein. |
| gufA2 protein network | https://string-db.org/network/268739.Nmlp_3750 | GufA family transport protein (probable substrate zinc). |
| Nmlp_3751 protein network | https://string-db.org/network/268739.Nmlp_3751 | IclR family transcription regulator. |
| valS protein network | https://string-db.org/network/268739.Nmlp_3753 | valine--tRNA ligase; Catalyzes the attachment of valine to tRNA(Val). As ValRS can inadvertently accommodate and process structurally similar amino acids such as threonine, to avoid such errors, [...] |
| Nmlp_3754 protein network | https://string-db.org/network/268739.Nmlp_3754 | EstB-type esterase domain protein. |
| Nmlp_3755 protein network | https://string-db.org/network/268739.Nmlp_3755 | Uncharacterized protein. |
| Nmlp_3756 protein network | https://string-db.org/network/268739.Nmlp_3756 | Probable oxidoreductase (aldo-keto reductase family protein). |
| Nmlp_3757 protein network | https://string-db.org/network/268739.Nmlp_3757 | MATE efflux family protein. |
| Nmlp_3758 protein network | https://string-db.org/network/268739.Nmlp_3758 | HAD superfamily hydrolase. |
| Nmlp_3759 protein network | https://string-db.org/network/268739.Nmlp_3759 | Beta-lactamase domain protein. |
| Nmlp_3760 protein network | https://string-db.org/network/268739.Nmlp_3760 | Uncharacterized protein. |
| Nmlp_3761 protein network | https://string-db.org/network/268739.Nmlp_3761 | UspA domain protein. |
| Nmlp_3762 protein network | https://string-db.org/network/268739.Nmlp_3762 | Uncharacterized protein. |
| Nmlp_3763 protein network | https://string-db.org/network/268739.Nmlp_3763 | Uncharacterized protein. |
| degP protein network | https://string-db.org/network/268739.Nmlp_3764 | Probable periplasmic serine protease. |
| Nmlp_3765 protein network | https://string-db.org/network/268739.Nmlp_3765 | Uncharacterized protein. |
| mptD protein network | https://string-db.org/network/268739.Nmlp_3766 | Dihydroneopterin aldolase, archaeal-type; Catalyzes the conversion of 7,8-dihydroneopterin (H2Neo) to 6-hydroxymethyl-7,8-dihydropterin (6-HMD); Belongs to the archaeal dihydroneopterin aldolase [...] |
| citB protein network | https://string-db.org/network/268739.Nmlp_3767 | Aconitate hydratase. |
| tif2b2 protein network | https://string-db.org/network/268739.Nmlp_3768 | Translation initiation factor aIF-2 beta subunit. |
| hisA protein network | https://string-db.org/network/268739.Nmlp_3769 | 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase. |
| fdx protein network | https://string-db.org/network/268739.Nmlp_3770 | Ferredoxin (2Fe-2S). |
| Nmlp_3771 protein network | https://string-db.org/network/268739.Nmlp_3771 | DUF2070 family protein. |
| Nmlp_3772 protein network | https://string-db.org/network/268739.Nmlp_3772 | DUF3194 family protein. |
| pfdB protein network | https://string-db.org/network/268739.Nmlp_3773 | Prefoldin beta subunit; Molecular chaperone capable of stabilizing a range of proteins. Seems to fulfill an ATP-independent, HSP70-like function in archaeal de novo protein folding. |
| Nmlp_3774 protein network | https://string-db.org/network/268739.Nmlp_3774 | TIGR00268 family protein. |
| Nmlp_3775 protein network | https://string-db.org/network/268739.Nmlp_3775 | Histidine kinase. |
| Nmlp_3776 protein network | https://string-db.org/network/268739.Nmlp_3776 | CobC/GpmA family phosphatase. |
| Nmlp_3777 protein network | https://string-db.org/network/268739.Nmlp_3777 | PQQ repeat protein. |
| Nmlp_3778 protein network | https://string-db.org/network/268739.Nmlp_3778 | DUF3209 family protein. |
| cbiX1 protein network | https://string-db.org/network/268739.Nmlp_3779 | Sirohydrochlorin cobaltochelatase. |
| Nmlp_3780 protein network | https://string-db.org/network/268739.Nmlp_3780 | Uncharacterized protein. |
| Nmlp_3781 protein network | https://string-db.org/network/268739.Nmlp_3781 | Probable ferredoxin (4Fe-4S). |
| cbiH2 protein network | https://string-db.org/network/268739.Nmlp_3782 | cobalt-factor-III C17-methyltransferase. |
| cbiH1 protein network | https://string-db.org/network/268739.Nmlp_3783 | cobalt-factor-III C17-methyltransferase. |
| cbiG protein network | https://string-db.org/network/268739.Nmlp_3784 | cobalt-precorrin-5A hydrolase. |
| cbiF protein network | https://string-db.org/network/268739.Nmlp_3785 | Cobalt-precorrin-4 C11-methyltransferase. |
| cbiL1 protein network | https://string-db.org/network/268739.Nmlp_3786 | cobalt-factor-II C20-methyltransferase; Belongs to the precorrin methyltransferase family. |
| cbiT protein network | https://string-db.org/network/268739.Nmlp_3787 | cobalt-precorrin-6B C15-methyltransferase (decarboxylating); Catalyzes the methylation of C-15 in cobalt-precorrin-6B followed by the decarboxylation of C-12 to form cobalt-precorrin-7. |
| adh protein network | https://string-db.org/network/268739.Nmlp_3788 | Alcohol dehydrogenase. |
| Nmlp_3789 protein network | https://string-db.org/network/268739.Nmlp_3789 | Uncharacterized protein. |
| Nmlp_3790 protein network | https://string-db.org/network/268739.Nmlp_3790 | AAA-type ATPase domain protein. |
| Nmlp_3791 protein network | https://string-db.org/network/268739.Nmlp_3791 | Uncharacterized protein. |
| Nmlp_3792 protein network | https://string-db.org/network/268739.Nmlp_3792 | HTH-10 family transcription regulator. |
| Nmlp_3793 protein network | https://string-db.org/network/268739.Nmlp_3793 | HTH domain protein. |
| Nmlp_3794 protein network | https://string-db.org/network/268739.Nmlp_3794 | Small CPxCG-related zinc finger protein. |
| Nmlp_3795 protein network | https://string-db.org/network/268739.Nmlp_3795 | FMN-binding domain protein. |
| Nmlp_3796 protein network | https://string-db.org/network/268739.Nmlp_3796 | Uncharacterized protein. |
| Nmlp_3797 protein network | https://string-db.org/network/268739.Nmlp_3797 | TIGR04031 family protein. |
| ahbC protein network | https://string-db.org/network/268739.Nmlp_3798 | Fe-coproporphyrin synthase AhbC. |
| Nmlp_3799 protein network | https://string-db.org/network/268739.Nmlp_3799 | MoaD family protein. |
| Nmlp_3801 protein network | https://string-db.org/network/268739.Nmlp_3801 | Flavin-containing amine-oxidoreductase. |
| Nmlp_3802 protein network | https://string-db.org/network/268739.Nmlp_3802 | Probable oxidoreductase (short-chain dehydrogenase family). |
| Nmlp_3803 protein network | https://string-db.org/network/268739.Nmlp_3803 | Uncharacterized protein. |
| Nmlp_3804 protein network | https://string-db.org/network/268739.Nmlp_3804 | Uncharacterized protein. |
| Nmlp_3805 protein network | https://string-db.org/network/268739.Nmlp_3805 | Uncharacterized protein. |
| Nmlp_3806 protein network | https://string-db.org/network/268739.Nmlp_3806 | ArsR family transcription regulator. |
| tif5B protein network | https://string-db.org/network/268739.Nmlp_3807 | Translation initiation factor aIF-5B (bacterial-type IF2); Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along w [...] |
| rnz protein network | https://string-db.org/network/268739.Nmlp_3808 | Ribonuclease Z; Zinc phosphodiesterase, which displays some tRNA 3'- processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA; Belongs [...] |
| Nmlp_3809 protein network | https://string-db.org/network/268739.Nmlp_3809 | arNOG05511 family protein (AAA-type ATPase core domain protein); Belongs to the AAA ATPase family. |
| Nmlp_3810 protein network | https://string-db.org/network/268739.Nmlp_3810 | Beta-lactamase domain protein. |
| Nmlp_3811 protein network | https://string-db.org/network/268739.Nmlp_3811 | ABC-type transport system ATP-binding protein. |
| Nmlp_3812 protein network | https://string-db.org/network/268739.Nmlp_3812 | ABC-type transport system permease protein. |
| Nmlp_3813 protein network | https://string-db.org/network/268739.Nmlp_3813 | DUF420 family protein. |
| Nmlp_3814 protein network | https://string-db.org/network/268739.Nmlp_3814 | Probable COG0212-type thiamine metabolism protein. |
| Nmlp_3815 protein network | https://string-db.org/network/268739.Nmlp_3815 | Uncharacterized protein. |
| Nmlp_3816 protein network | https://string-db.org/network/268739.Nmlp_3816 | UPF0272 family protein; Belongs to the LarC family. |
| glnA protein network | https://string-db.org/network/268739.Nmlp_3817 | Glutamine synthetase. |
| Nmlp_3818 protein network | https://string-db.org/network/268739.Nmlp_3818 | Lrp/AsnC family transcription regulator. |
| Nmlp_3819 protein network | https://string-db.org/network/268739.Nmlp_3819 | Uncharacterized protein. |
| hisH protein network | https://string-db.org/network/268739.Nmlp_3820 | Imidazoleglycerol-phosphate synthase subunit HisH; IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glut [...] |
| Nmlp_3821 protein network | https://string-db.org/network/268739.Nmlp_3821 | Uncharacterized protein. |
| udg protein network | https://string-db.org/network/268739.Nmlp_3822 | uracil-DNA glycosylase. |
| Nmlp_3823 protein network | https://string-db.org/network/268739.Nmlp_3823 | UPF0215 family protein; Belongs to the UPF0215 family. |
| Nmlp_3824 protein network | https://string-db.org/network/268739.Nmlp_3824 | Uncharacterized protein. |
| Nmlp_3825 protein network | https://string-db.org/network/268739.Nmlp_3825 | Sensor box histidine kinase. |
| Nmlp_3826 protein network | https://string-db.org/network/268739.Nmlp_3826 | Beta-lactamase domain protein. |
| Nmlp_3827 protein network | https://string-db.org/network/268739.Nmlp_3827 | Homolog to cytochrome c-type biogenesis protein. |
| trxA8 protein network | https://string-db.org/network/268739.Nmlp_3828 | Thioredoxin. |
| Nmlp_3829 protein network | https://string-db.org/network/268739.Nmlp_3829 | DoxX domain protein. |
| rps10a protein network | https://string-db.org/network/268739.Nmlp_3830 | 30S ribosomal protein S10a; Involved in the binding of tRNA to the ribosomes. Belongs to the universal ribosomal protein uS10 family. |
| tef1a protein network | https://string-db.org/network/268739.Nmlp_3831 | Translation elongation factor aEF-1 alpha subunit; This protein promotes the GTP-dependent binding of aminoacyl- tRNA to the A-site of ribosomes during protein biosynthesis. Belongs to the TRAFAC [...] |
| hom protein network | https://string-db.org/network/268739.Nmlp_3832 | Homoserine dehydrogenase. |
| Nmlp_3833 protein network | https://string-db.org/network/268739.Nmlp_3833 | ACT domain protein. |
| tef2 protein network | https://string-db.org/network/268739.Nmlp_3834 | Translation elongation factor aEF-2; Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (P [...] |
| Nmlp_3835 protein network | https://string-db.org/network/268739.Nmlp_3835 | Uncharacterized protein. |
| Nmlp_3836 protein network | https://string-db.org/network/268739.Nmlp_3836 | Uncharacterized protein. |
| Nmlp_3837 protein network | https://string-db.org/network/268739.Nmlp_3837 | Probable sugar dehydrogenase (homolog to aldose sugar dehydrogenase). |
| rps7 protein network | https://string-db.org/network/268739.Nmlp_3838 | 30S ribosomal protein S7; One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit inte [...] |
| rps12 protein network | https://string-db.org/network/268739.Nmlp_3839 | 30S ribosomal protein S12; With S4 and S5 plays an important role in translational accuracy. Located at the interface of the 30S and 50S subunits. Belongs to the universal ribosomal protein uS12 [...] |
| Nmlp_3840 protein network | https://string-db.org/network/268739.Nmlp_3840 | PadR family transcription regulator. |
| nusA protein network | https://string-db.org/network/268739.Nmlp_3841 | Transcription elongation factor NusA; Participates in transcription termination. Belongs to the NusA family. |
| rpoA2 protein network | https://string-db.org/network/268739.Nmlp_3842 | DNA-directed RNA polymerase subunit A'; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. |
| rpoA1 protein network | https://string-db.org/network/268739.Nmlp_3843 | DNA-directed RNA polymerase subunit A; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. |
| rpoB1 protein network | https://string-db.org/network/268739.Nmlp_3844 | DNA-directed RNA polymerase subunit B; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. |
| rpoB2 protein network | https://string-db.org/network/268739.Nmlp_3845 | DNA-directed RNA polymerase subunit B''; Belongs to the RNA polymerase beta chain family. |
| rpoH protein network | https://string-db.org/network/268739.Nmlp_3846 | DNA-directed RNA polymerase subunit H; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Belongs to the archaeal [...] |
| pheA protein network | https://string-db.org/network/268739.Nmlp_3847 | Prephenate dehydratase. |
| Nmlp_3848 protein network | https://string-db.org/network/268739.Nmlp_3848 | Uncharacterized protein. |
| uvrB protein network | https://string-db.org/network/268739.Nmlp_3849 | UvrABC system protein B; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnorm [...] |
| Nmlp_3851 protein network | https://string-db.org/network/268739.Nmlp_3851 | Abi/CAAX domain protein. |
| lon protein network | https://string-db.org/network/268739.Nmlp_3852 | ATP-dependent protease Lon; Belongs to the peptidase S16 family. |
| nadM protein network | https://string-db.org/network/268739.Nmlp_3853 | Nicotinamide-nucleotide adenylyltransferase. |
| Nmlp_3854 protein network | https://string-db.org/network/268739.Nmlp_3854 | S-adenosylmethionine hydroxide adenosyltransferase family protein. |
| Nmlp_3855 protein network | https://string-db.org/network/268739.Nmlp_3855 | Uncharacterized protein. |
| trm14 protein network | https://string-db.org/network/268739.Nmlp_3856 | tRNA (guanine(6)-N(2))-dimethyltransferase. |
| Nmlp_3857 protein network | https://string-db.org/network/268739.Nmlp_3857 | Uncharacterized protein. |
| proC protein network | https://string-db.org/network/268739.Nmlp_3858 | Pyrroline-5-carboxylate reductase; Catalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline. |
| proB protein network | https://string-db.org/network/268739.Nmlp_3859 | Glutamate 5-kinase; Catalyzes the transfer of a phosphate group to glutamate to form L-glutamate 5-phosphate. |
| proA protein network | https://string-db.org/network/268739.Nmlp_3860 | Gamma-glutamyl phosphate reductase; Catalyzes the NADPH-dependent reduction of L-glutamate 5- phosphate into L-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes cyclizat [...] |
| Nmlp_3861 protein network | https://string-db.org/network/268739.Nmlp_3861 | Uncharacterized protein. |
| rlmE protein network | https://string-db.org/network/268739.Nmlp_3862 | 23S rRNA (uridine-2'-O-) methyltransferase; Specifically methylates the uridine in position 2552 of 23S rRNA at the 2'-O position of the ribose in the fully assembled 50S ribosomal subunit. |
| Nmlp_3863 protein network | https://string-db.org/network/268739.Nmlp_3863 | Uncharacterized protein. |
| Nmlp_3864 protein network | https://string-db.org/network/268739.Nmlp_3864 | PIN domain protein. |
| Nmlp_3865 protein network | https://string-db.org/network/268739.Nmlp_3865 | Uncharacterized protein. |
| Nmlp_3866 protein network | https://string-db.org/network/268739.Nmlp_3866 | SNF family transport protein. |
| Nmlp_3867 protein network | https://string-db.org/network/268739.Nmlp_3867 | DUF165 family protein; Involved in the import of queuosine (Q) precursors, required for Q precursor salvage; Belongs to the vitamin uptake transporter (VUT/ECF) (TC 2.A.88) family. Q precursor tr [...] |
| Nmlp_3868 protein network | https://string-db.org/network/268739.Nmlp_3868 | CopG domain protein. |
| gatD protein network | https://string-db.org/network/268739.Nmlp_3869 | glutamyl-tRNA(Gln) amidotransferase subunit D; Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-t [...] |
| Nmlp_3870 protein network | https://string-db.org/network/268739.Nmlp_3870 | Uncharacterized protein. |
| Nmlp_3871 protein network | https://string-db.org/network/268739.Nmlp_3871 | Ubiquitin-like protein. |
| samp3 protein network | https://string-db.org/network/268739.Nmlp_3872 | Ubiquitin-like modifier protein SAMP3. |
| Nmlp_3873 protein network | https://string-db.org/network/268739.Nmlp_3873 | Uncharacterized protein. |
| arcS protein network | https://string-db.org/network/268739.Nmlp_3874 | Archaeosine synthase. |
| rad3b protein network | https://string-db.org/network/268739.Nmlp_3875 | DNA repair helicase Rad3. |
| Nmlp_3876 protein network | https://string-db.org/network/268739.Nmlp_3876 | Uncharacterized protein. |
| Nmlp_3877 protein network | https://string-db.org/network/268739.Nmlp_3877 | NUDIX family hydrolase. |
| Nmlp_3878 protein network | https://string-db.org/network/268739.Nmlp_3878 | Uncharacterized protein. |
| dcd protein network | https://string-db.org/network/268739.Nmlp_3879 | dCTP deaminase; Catalyzes the deamination of dCTP to dUTP. |
| thiN1 protein network | https://string-db.org/network/268739.Nmlp_3880 | HTH domain protein / thiamine-phosphate synthase. |
| Nmlp_3881 protein network | https://string-db.org/network/268739.Nmlp_3881 | Uncharacterized protein. |
| thi4 protein network | https://string-db.org/network/268739.Nmlp_3882 | Thiamine thiazole synthase; Involved in the biosynthesis of the thiazole moiety of thiamine. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazo [...] |
| Nmlp_3883 protein network | https://string-db.org/network/268739.Nmlp_3883 | Uncharacterized protein. |
| thiDN protein network | https://string-db.org/network/268739.Nmlp_3884 | Phosphomethylpyrimidine kinase / phosphomethylpyrimidine phosphate kinase / thiamine-phosphate synthase. |
| Nmlp_3885 protein network | https://string-db.org/network/268739.Nmlp_3885 | Uncharacterized protein. |
| mutS1b protein network | https://string-db.org/network/268739.Nmlp_3886 | DNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. |
| mutL protein network | https://string-db.org/network/268739.Nmlp_3887 | DNA mismatch repair protein MutL; This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a 'molecular matchm [...] |
| Nmlp_3888 protein network | https://string-db.org/network/268739.Nmlp_3888 | MATE efflux family protein. |
| pheT protein network | https://string-db.org/network/268739.Nmlp_3889 | phenylalanine--tRNA ligase beta subunit. |
| pheS protein network | https://string-db.org/network/268739.Nmlp_3890 | phenylalanine--tRNA ligase alpha subunit. |
| Nmlp_3891 protein network | https://string-db.org/network/268739.Nmlp_3891 | Uncharacterized protein. |
| Nmlp_3892 protein network | https://string-db.org/network/268739.Nmlp_3892 | Uncharacterized protein. |
| Nmlp_3893 protein network | https://string-db.org/network/268739.Nmlp_3893 | Uncharacterized protein. |
| Nmlp_3894 protein network | https://string-db.org/network/268739.Nmlp_3894 | Uncharacterized protein. |
| cheY2 protein network | https://string-db.org/network/268739.Nmlp_3895 | Response regulator CheY. |
| Nmlp_3896 protein network | https://string-db.org/network/268739.Nmlp_3896 | Alpha/beta hydrolase fold protein. |
| Nmlp_3897 protein network | https://string-db.org/network/268739.Nmlp_3897 | Uncharacterized protein. |
| parA1 protein network | https://string-db.org/network/268739.Nmlp_3898 | ParA domain protein. |
| Nmlp_3900 protein network | https://string-db.org/network/268739.Nmlp_3900 | Uncharacterized protein. |
| Nmlp_3901 protein network | https://string-db.org/network/268739.Nmlp_3901 | Uncharacterized protein. |
| tuc1 protein network | https://string-db.org/network/268739.Nmlp_3902 | Putative tRNA 2-thiolation protein. |
| ftsZ2 protein network | https://string-db.org/network/268739.Nmlp_3903 | Cell division protein FtsZ, type II; Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly control [...] |
| Nmlp_3904 protein network | https://string-db.org/network/268739.Nmlp_3904 | CopG domain protein. |
| Nmlp_3905 protein network | https://string-db.org/network/268739.Nmlp_3905 | DZR domain protein. |
| Nmlp_3909 protein network | https://string-db.org/network/268739.Nmlp_3909 | Uncharacterized protein; Gene has a frameshift; locus_tag: Nmlp_3908; product: uncharacterized protein (nonfunctional). |
| Nmlp_3910 protein network | https://string-db.org/network/268739.Nmlp_3910 | Cupin 2 barrel domain protein. |
| Nmlp_3911 protein network | https://string-db.org/network/268739.Nmlp_3911 | Alpha/beta hydrolase fold protein. |
| Nmlp_3912 protein network | https://string-db.org/network/268739.Nmlp_3912 | Small CPxCG-related zinc finger protein. |
| Nmlp_3913 protein network | https://string-db.org/network/268739.Nmlp_3913 | Uncharacterized protein. |
| grx1 protein network | https://string-db.org/network/268739.Nmlp_3914 | Glutaredoxin. |
| Nmlp_3915 protein network | https://string-db.org/network/268739.Nmlp_3915 | Uncharacterized protein. |
| hemL protein network | https://string-db.org/network/268739.Nmlp_3916 | Glutamate-1-semialdehyde 2,1-aminomutase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. HemL subfamily. |
| Nmlp_3917 protein network | https://string-db.org/network/268739.Nmlp_3917 | Lrp/AsnC family transcription regulator. |
| amtB1 protein network | https://string-db.org/network/268739.Nmlp_3918 | Transport protein (probable substrate ammonium); Belongs to the P(II) protein family. |
| hemB protein network | https://string-db.org/network/268739.Nmlp_3919 | Porphobilinogen synthase; Belongs to the ALAD family. |
| ogt protein network | https://string-db.org/network/268739.Nmlp_3920 | Probable methylated-DNA--protein-cysteine methyltransferase. |
| Nmlp_3921 protein network | https://string-db.org/network/268739.Nmlp_3921 | Uncharacterized protein. |
| Nmlp_3922 protein network | https://string-db.org/network/268739.Nmlp_3922 | DUF3426 domain protein. |
| Nmlp_3923 protein network | https://string-db.org/network/268739.Nmlp_3923 | Small CPxCG-related zinc finger protein. |
| sec11 protein network | https://string-db.org/network/268739.Nmlp_3924 | Signal peptidase I. |
| phaC protein network | https://string-db.org/network/268739.Nmlp_3925 | Poly(3-hydroxyalkanoate) synthase PhaC. |
| phaE protein network | https://string-db.org/network/268739.Nmlp_3926 | Poly(3-hydroxyalkanoate) synthase PhaE. |
| Nmlp_3927 protein network | https://string-db.org/network/268739.Nmlp_3927 | arCOG06342 family protein. |
| Nmlp_3928 protein network | https://string-db.org/network/268739.Nmlp_3928 | PHA granule-associated 12K protein. |
| phaJ protein network | https://string-db.org/network/268739.Nmlp_3929 | (R)-specific enoyl-CoA hydratase. |
| Nmlp_3930 protein network | https://string-db.org/network/268739.Nmlp_3930 | Uncharacterized protein. |
| CEK41125.1 protein network | https://string-db.org/network/268739.Nmlp_3930A | Small CPxCG-related zinc finger protein. |
| cgi121 protein network | https://string-db.org/network/268739.Nmlp_3931 | KEOPS complex subunit Cgi121. |
| hel308a protein network | https://string-db.org/network/268739.Nmlp_3932 | ATP-dependent DNA helicase Hel308; DNA-dependent ATPase and 3'-5' DNA helicase that may be involved in repair of stalled replication forks. |
| Nmlp_3933 protein network | https://string-db.org/network/268739.Nmlp_3933 | Receiver/sensor box histidine kinase. |
| ferC protein network | https://string-db.org/network/268739.Nmlp_3934 | Ferredoxin (4Fe-4S). |
| mdh protein network | https://string-db.org/network/268739.Nmlp_3935 | Malate dehydrogenase; Belongs to the LDH/MDH superfamily. |
| uvrA protein network | https://string-db.org/network/268739.Nmlp_3936 | UvrABC system protein A; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrA is an ATPase and a DNA-binding protein. A damage recognition complex composed of 2 [...] |
| polD1 protein network | https://string-db.org/network/268739.Nmlp_3937 | DNA-directed DNA polymerase D exonuclease subunit DP1; Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3' to 5' dire [...] |
| Nmlp_3938 protein network | https://string-db.org/network/268739.Nmlp_3938 | Uncharacterized protein. |
| Nmlp_3939 protein network | https://string-db.org/network/268739.Nmlp_3939 | Uncharacterized protein. |
| Nmlp_3940 protein network | https://string-db.org/network/268739.Nmlp_3940 | DUF296 family protein. |
| polD2 protein network | https://string-db.org/network/268739.Nmlp_3941 | DNA-directed DNA polymerase D large subunit (intein-containing); Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- [...] |
| Nmlp_3944 protein network | https://string-db.org/network/268739.Nmlp_3944 | Uncharacterized protein. |
| Nmlp_3945 protein network | https://string-db.org/network/268739.Nmlp_3945 | Uncharacterized protein. |
| hcp3 protein network | https://string-db.org/network/268739.Nmlp_3945A | Halocyanin. |
| mutS5a protein network | https://string-db.org/network/268739.Nmlp_3947 | DNA mismatch repair protein MutS; Has ATPase and non-specific DNA-binding activities. Belongs to the DNA mismatch repair MutS family. Archaeal Muts2 subfamily. |
| orc2 protein network | https://string-db.org/network/268739.Nmlp_3948 | Orc1-type DNA replication protein; Involved in regulation of DNA replication. |